PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_32098_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 374aa    MW: 41288.5 Da    PI: 8.1663
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_32098_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.19.8e-344498155
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                kprl+Wtp+LHerF+eav+qLGG++kAtPkt++++m+++gLtl+h+kSHLQkYRl
  Cotton_A_32098_BGI-A2_v1.0 44 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKIMGIPGLTLYHLKSHLQKYRL 98
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.90441101IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-314299IPR009057Homeodomain-like
SuperFamilySSF466898.6E-1743100IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-234499IPR006447Myb domain, plants
PfamPF002491.2E-94697IPR001005SANT/Myb domain
PfamPF143794.1E-25145190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MYHHHHQGKN IQACLRTAIP DRHLLLQGGN GTGDSGLVLS TDAKPRLKWT PDLHERFIEA  60
VNQLGGADKA TPKTVMKIMG IPGLTLYHLK SHLQKYRLSK NPHGQANNGS NKIGAVAMPA  120
DKISEANGIQ MNNSTVGPQT NRGLQISEAL QMQIEVQRRL HEQLEVQRHL QLRIEAQGKY  180
LQSVLEKAQE SLGRQNPGSM GLEAAQLQLS ELVSKVSNQC LDSTLMDLKE LQGLCHQKTK  240
TNSIDSCLTS IEGSQKDQEI HNNGICLRPY SLVAEDPWLP QTGLRENKMV PSSTAKIADR  300
SSNGSDLSIT VGLQGDKGKG FNSNSSRFSE RKFNGRNEDD GLHYFATKLD LNVDEENDVA  360
SRCKQFDLNG LSWG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5873153e-68JX587315.1 Gossypium hirsutum clone NBRI_GE21375 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016674129.10.0PREDICTED: two-component response regulator ORR24-like
RefseqXP_017618814.10.0PREDICTED: myb-related protein 1-like
SwissprotQ9FK471e-137PHLA_ARATH; Myb-related protein 1
TrEMBLA0A1U8IE940.0A0A1U8IE94_GOSHI; two-component response regulator ORR24-like
STRINGGorai.013G122900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.41e-139myb-related protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]