PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_31019_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 441aa    MW: 48524 Da    PI: 7.3706
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_31019_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32233288156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Cotton_A_31019_BGI-A2_v1.0 233 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 288
                                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.22230290IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-28231291IPR009057Homeodomain-like
SuperFamilySSF466897.17E-17231291IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26233288IPR006447Myb domain, plants
PfamPF002497.6E-7235286IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MASSSSSELT LDCKPHGHFA APSKCYADQQ QIVVVNHTLK LEDYLSRLEE ERLKIDAFKR  60
ELPLCMQLLT NALESSRQQL QAYRANQGPK PVLEEFMPLK TSVSENIDKS QTISDHKANW  120
MTTAQLWSQA GHYETKQQSS SITTSSPKDT DIGLNVVSPK LGSSLDSKQR IGGAFLPFSK  180
DRNSCSSALP DLSLASSDTE NGTSCQQRGD GTSNNRTDGQ TTNGSNTNQP HRKARRCWSP  240
DLHRRFVNAL QMLGGSQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSPIPQAAG  300
APTPQLVVLG GIWVPPEYAT AAHSGGPAMY GAHHHHHPAV PHAPPHFCAS PVPQEFYTTA  360
ATPALPPPHH TFHHQLHNMY NARNSPEPDV REAGDRSESI EDGKSESGSW KGESCGDQRI  420
GLAALREEGE ESNRSEITLK F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-14233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-14233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-14233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-14233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6150640.0JX615064.1 Gossypium hirsutum clone NBRI_GE58863 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017641049.10.0PREDICTED: myb family transcription factor EFM-like
SwissprotQ9ZQ851e-122EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A1U8LX560.0A0A1U8LX56_GOSHI; probable transcription factor GLK2
STRINGGorai.001G002800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-110G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]