PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_30808_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 246aa    MW: 28500.6 Da    PI: 6.788
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_30808_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.65e-27188237251
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                 +r++W++eLH+rFvea++ LGG+e+AtPk+i++lm+v+gLt+e+vkSHLQ
  Cotton_A_30808_BGI-A2_v1.0 188 NRRCWSSELHSRFVEALNMLGGIEVATPKQIRNLMQVEGLTIEQVKSHLQ 237
                                 79************************************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.445184244IPR017930Myb domain
SuperFamilySSF466891.29E-13185238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-22186237IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-22187238IPR006447Myb domain, plants
PfamPF002491.6E-6189237IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MNPSSIELSL SLKPSYVPKS RSSLLLDLSK IDNQYYKLSV LSDYICKLEE ELARVQPFKH  60
LLPLCTLLLM EVWAHGLIDP ITYETETLKD KLLNINNEKE QREIQEECDA NLQSCKEKGN  120
NMERLMLGYK KNSTWNSVGE SSSDGKGKEV AAIDQYSWRN DNQGFMYLNN YDHHHHPKPL  180
TQPIWKNNRR CWSSELHSRF VEALNMLGGI EVATPKQIRN LMQVEGLTIE QVKSHLQVII  240
HLFMLN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5822325e-72JX582232.1 Gossypium hirsutum clone NBRI_GE15026 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017637644.11e-145PREDICTED: uncharacterized protein LOC108479503
TrEMBLA0A2P5YB771e-152A0A2P5YB77_GOSBA; Uncharacterized protein
STRINGGorai.001G089700.11e-133(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15410716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.28e-24G2-like family protein