PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_30275_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 696aa    MW: 75984.8 Da    PI: 7.5364
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_30275_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.5e-093934301954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +++  LAk++gLt  qV++WF N R +
  Cotton_A_30275_BGI-A2_v1.0 393 FEHflHPYPKDSDKHMLAKQTGLTRGQVSNWFINARVR 430
                                 554459******************************88 PP

2BELL47.44.9e-162943283872
                        BELL  38 eavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 ++vaglg+ak+Yt+lAlk+iS++FrcLkdai++q+
  Cotton_A_30275_BGI-A2_v1.0 294 DEVAGLGAAKSYTALALKTISKQFRCLKDAISGQM 328
                                 689*****************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.0E-36207326IPR006563POX domain
PfamPF075265.3E-18212296IPR006563POX domain
PfamPF075267.4E-11294325IPR006563POX domain
PROSITE profilePS5007111.872371434IPR001356Homeobox domain
SMARTSM003891.3E-8374438IPR001356Homeobox domain
CDDcd000861.61E-11374435No hitNo description
SuperFamilySSF466891.92E-16375440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28377440IPR009057Homeodomain-like
PfamPF059201.4E-17391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MATYFHGSSD FQAASADGMQ TLYLMNPNYV PYADTHQQPS AATNMFFLNP TSLPQAPPPN  60
HHQRFLGLPL PTPSTAIKPL NSDDPHRPSP LQGVVPGFHS NLWGSSVDHQ NSPGSSHPQV  120
VSAAATGDNS GGSHDVASQS GFQRPVVSPR QGLSLSLSSQ QVGYRSSNNV ETDIQGQPQV  180
PTMSLGEDVR ISGNSPSSVS VVSNGISGAQ SVVLGSKYLR AAQELLDEVV NVGKGIKTDV  240
SEGTKEEKIK VNKESVAGEG SSAGENGAKR GAELTTAQRQ ELQMKKAKLV SMLDEVAGLG  300
AAKSYTALAL KTISKQFRCL KDAISGQMKA TSKSLGEEDC LGAKVEGSRL RYVDHQLRQQ  360
RTLQQLGMIQ HNAWRPQRGL PERAVSVLRA WLFEHFLHPY PKDSDKHMLA KQTGLTRGQV  420
SNWFINARVR LWKPMVEEMY LEEVKEQERN GSEVKANRSV QKESESSSSA HQENVSFMMN  480
QVKAQSQPEK SINQQQNMPP TEFSNSTMGG SFLPQTATAF NLIGSCDLDS AAQRSPKKPR  540
SSVNELQNSP SSILSMDMEM KQGETREINM NFGDERLPKD SYSFFTGTDN TGSGFPTYSA  600
MGDIGRFDPN QLTQRFHGNS VSLTLGLPHC ENLSLSGNHQ SLLSNQNIQL GRRLELGQSE  660
VDFCGINNTQ QASHSSTFEM QNRKRFAAQL LPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16380438563Homeobox protein Meis2
3k2a_B2e-16380438563Homeobox protein Meis2
4xrm_A2e-16380438563Homeobox protein Meis2
4xrm_B2e-16380438563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6152602e-95JX615260.1 Gossypium hirsutum clone NBRI_GE59161 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485171.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012485172.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0D2Q7Y90.0A0A0D2Q7Y9_GOSRA; Uncharacterized protein
STRINGGorai.006G115600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16274513
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-103BEL1-like homeodomain 1