PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_29834_BGI-A2_v1.0
Common NameF383_29941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 302aa    MW: 33129.5 Da    PI: 6.5117
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_29834_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1092.4e-343993155
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Cotton_A_29834_BGI-A2_v1.0 39 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 93
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-333694IPR009057Homeodomain-like
PROSITE profilePS5129413.0953696IPR017930Myb domain
SuperFamilySSF466891.77E-173896IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-243994IPR006447Myb domain, plants
PfamPF002499.1E-94192IPR001005SANT/Myb domain
PfamPF143797.6E-25137183IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MYSAIRSLPL DGRVGDYQGS LDGTNLPGDA CLVLTTDPKP RLRWTAELHE RFVDAVTQLG  60
GPDKATPKTI MRTMGVKGLT LYHLKSHLQK YRLGKQSCKE SIDNSKDASC VAESQDTGSS  120
TTSSSRMVAQ DLNDGYQVTE ALRAQMEVQR KLHEQLEVQH RLQLRIEAQS KYLQSMLEKA  180
CKALNDQDQA ASTGLEAARE ELSELAIKVS NDCQGMIPPH DNIKLPSLSE LAVVLENNRT  240
SNMPGRIGDC SVESCLTSSG SPVSSQAGIM KKRPRSMFGN GEPLPLDGNI RQEIEWGMPN  300
IS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-203995258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-203995258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-203995157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-203995157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-203995157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-203995157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-203995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-203995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-203995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-203995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-203995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-203995258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017608816.10.0PREDICTED: protein PHR1-LIKE 3-like isoform X1
SwissprotQ8LAJ71e-144PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A0B0PDH20.0A0A0B0PDH2_GOSAR; Myb family transcription factor APL
STRINGGorai.011G158500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-133G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]