PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_29132_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 323aa    MW: 36219.9 Da    PI: 5.7765
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_29132_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.65.2e-161152344
                                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                                i+++  r+v++ kRr g++KK +EL +LC++++++ii+s++ 
  Cotton_A_29132_BGI-A2_v1.0 11 ISDDNARNVSLEKRRLGLMKKMSELTTLCGIRACLIIYSPNE 52
                                8999***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.035151IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-21160IPR002100Transcription factor, MADS-box
CDDcd002661.34E-25285No hitNo description
SuperFamilySSF554555.89E-22295IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-5323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MTRKKVTLAW ISDDNARNVS LEKRRLGLMK KMSELTTLCG IRACLIIYSP NESEPMVWPS  60
HAEVQRQLEE YWKTFELDRL KKMVNQETYL KERITKAKEQ LRKLQRKNNE VEMGHLMHQI  120
EQGKGIDEYN NGELHRLKWL VEEKMDEIQK RIEFFHQLPQ GDPTAQTVGG GHKPLMMNQR  180
FTNMVNNNEH TLGDIMAQDH LGQLLGHNLG GDSDVGVPLY GDLRGTITDM GQQLLGFRPY  240
GDGATEMGLP HGSTIGSNNI SGAFGNDIGM VGHPFECIGS SYNVSEQGVA WPLGGDGGDN  300
CGGTSNGIDM QFDEQSWPNN FAA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017629269.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A1U8L3F50.0A0A1U8L3F5_GOSHI; MADS-box transcription factor PHERES 2-like
STRINGGorai.007G363700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-35AGAMOUS-like 80