PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_29042_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 459aa    MW: 51953.6 Da    PI: 5.3556
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_29042_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box231.7e-07848337
                    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                                +  C  +++k++ l+C  ++  lC  C ++ H+       H
  Cotton_A_29042_BGI-A2_v1.0  8 MSLCHFCKSKPAVLYCSADSARLCLFCDQQVHSAnalslkH 48
                                678*****************************655666666 PP

2zf-B_box18.93.2e-065184336
                    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                                 ++C+ ++ k++++ C  +  +lC+dC  ++H++
  Cotton_A_29042_BGI-A2_v1.0 51 SQICDGCKAKPASFLCSIDYLMLCHDCDWSSHNN 84
                                689*****************************87 PP

3CCT62.31.5e-21412456145
                         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                                 R++a+lRYkeK+k+R+++K+irYesRK++A++R+R KGrFvk++e
  Cotton_A_29042_BGI-A2_v1.0 412 RDNAMLRYKEKKKHRRYDKQIRYESRKTRADTRKRFKGRFVKASE 456
                                 899***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.8E-9653IPR000315B-box-type zinc finger
PROSITE profilePS501199.755653IPR000315B-box-type zinc finger
PfamPF006437.9E-6850IPR000315B-box-type zinc finger
CDDcd000211.99E-51041No hitNo description
PROSITE profilePS501199.01549105IPR000315B-box-type zinc finger
SMARTSM00336254105IPR000315B-box-type zinc finger
PROSITE profilePS5101714.733412454IPR010402CCT domain
PfamPF062031.2E-15412454IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
PKPRRSTMSL CHFCKSKPAV LYCSADSARL CLFCDQQVHS ANALSLKHVR SQICDGCKAK  60
PASFLCSIDY LMLCHDCDWS SHNNNNSSSS SSSSCVSAMH ERAPVEGFSG RPSVVELASL  120
FGFDLKPKDL MNLIPGFSLY ERELMNLEDF MVPDEENSCV SSALISSVKL DHEVYRQLVD  180
MGKRGLVRGS GDGAELGPGT PPITSAEQEN FASFEVENGY DEEQLQQQTP FTSLLTFQSD  240
DVLRQNDYVA EGELVWDCKS SYLPSQIWDF QSERSKDCEE SGAEDAGFVK GWSFFRKLFL  300
VMFNFVDKVH NCHLNHMICY ITCLCVLYCF NFGNCCIDLM ADYTLQNTCN EAFSSNKPTT  360
EESNNVVESL ETPICDSTRY VQVMEHPIVG GSEVMNYEAK PNVDIEPLAQ NRDNAMLRYK  420
EKKKHRRYDK QIRYESRKTR ADTRKRFKGR FVKASEAPD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3936022e-48GQ393602.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0567 SSR marker CGR5610 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017614324.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
TrEMBLA0A0B0NAQ30.0A0A0B0NAQ3_GOSAR; Zinc finger CONSTANS-LIKE 14-like protein
STRINGGorai.012G083100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1922677
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.11e-66B-box type zinc finger protein with CCT domain