PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_28699_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 427aa    MW: 46800.9 Da    PI: 6.4653
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_28699_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.63.9e-06234335
                    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                                e++C+ +  +++  +C++++  lC +C    H+
  Cotton_A_28699_BGI-A2_v1.0  2 EPVCDFCRGERAVVYCKSDSARLCLSCDGCVHS 34
                                689************************998885 PP

2CCT591.7e-20371414144
                         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                 R++a+ RY+eK+ktR F K+irY+sRKa+A++R+RvKGrFvk+ 
  Cotton_A_28699_BGI-A2_v1.0 371 RDKAKIRYNEKKKTRIFGKQIRYASRKARADTRKRVKGRFVKAG 414
                                 888999***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.684146IPR000315B-box-type zinc finger
SMARTSM003361.3E-9147IPR000315B-box-type zinc finger
CDDcd000213.50E-5347No hitNo description
PROSITE profilePS5101714.426371413IPR010402CCT domain
PfamPF062035.4E-16371413IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MEPVCDFCRG ERAVVYCKSD SARLCLSCDG CVHSANLLSR RHVRSLLCEK CNSQSAVVRC  60
LDEKLSLCQD CDGNGNGCWS LGHWREALNS YTDCPSLAEF RRIWSSVLGA SSPAVFDVDW  120
PVGASAANDN CFTNCLNQID QGGSFELAGT KLNELDSCPK LKPCMVSSSL ISPNANYVPY  180
CKDGEPVFSE EPNMPKGYSD LRDFKVPDGD DLCEGLNIND AQFSFETANE IFGGSQGQTR  240
YQFEKVGTDC LIMDKTLPVI ESNGPSKNML EALPSGQKEC QPFPSPQVGC SASMMATMIG  300
TSNCMLMNPG CNRNINLGYP VGQVPSNLAP SPSNITVKTS PAGFQDCGLP PGFLTGDSHF  360
QNLEVSCPQA RDKAKIRYNE KKKTRIFGKQ IRYASRKARA DTRKRVKGRF VKAGEEYDYD  420
PLVARNF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5780783e-59JX578078.1 Gossypium hirsutum clone NBRI_GE10025 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017618706.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11
TrEMBLA0A1U8I9B00.0A0A1U8I9B0_GOSHI; zinc finger protein CONSTANS-LIKE 12-like
STRINGGorai.013G071300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.14e-92B-box type zinc finger protein with CCT domain