PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_28206_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 80aa    MW: 9194.84 Da    PI: 10.4735
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_28206_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.43.8e-131051344
                                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                                i ++  r  +  kRr g+ KK  EL +LC++e++++i+s++ 
  Cotton_A_28206_BGI-A2_v1.0 10 IADNAARRASPKKRRLGLVKKVMELTTLCGTEACLVIYSPDE 51
                                667777888999***************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.344148IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-11159IPR002100Transcription factor, MADS-box
CDDcd002661.21E-21168No hitNo description
PRINTSPR004043.5E-5222IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-17374IPR002100Transcription factor, MADS-box
PfamPF003197.0E-141053IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-52237IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-53758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MTKRVKLAWI ADNAARRASP KKRRLGLVKK VMELTTLCGT EACLVIYSPD EQPPVVWPSH  60
DEVQRLIKFY QAPDFNALRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453454.13e-34PREDICTED: agamous-like MADS-box protein AGL92
TrEMBLA0A2P5Y6G83e-37A0A2P5Y6G8_GOSBA; Uncharacterized protein
STRINGGorai.011G177600.17e-33(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.22e-20M-type_MADS family protein