PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_27818_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 423aa    MW: 48546.7 Da    PI: 6.1544
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_27818_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-093413762055
                                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                 +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Cotton_A_27818_BGI-A2_v1.0 341 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 376
                                 5679*****************************885 PP

2ELK37.74.5e-13296317122
                         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                 ELK++LlrKYsgyL+sLkqE+s
  Cotton_A_27818_BGI-A2_v1.0 296 ELKNHLLRKYSGYLSSLKQELS 317
                                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.5E-23107151IPR005540KNOX1
PfamPF037901.2E-23108150IPR005540KNOX1
SMARTSM012561.6E-28158209IPR005541KNOX2
PfamPF037913.3E-23162208IPR005541KNOX2
SMARTSM011883.5E-7296317IPR005539ELK domain
PfamPF037893.0E-10296317IPR005539ELK domain
PROSITE profilePS5121311.296296316IPR005539ELK domain
PROSITE profilePS5007113.086316379IPR001356Homeobox domain
SuperFamilySSF466896.84E-20317391IPR009057Homeodomain-like
SMARTSM003892.4E-13318383IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-27321382IPR009057Homeodomain-like
CDDcd000863.24E-11328380No hitNo description
PfamPF059201.3E-16336375IPR008422Homeobox KN domain
PROSITE patternPS000270354377IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MEDYNQLNEN STPRGNFLYA TPVLASNSSP YGRGSSGSNV SNQQVEMPLI SFQFQSSECY  60
QSEVHPIVKT EASTSQHGQK FHYPLLREHQ AAVHHQQDRN ESSSEVEAIK AKIIAHPQYS  120
NLLEAYMDCQ KVGAPPDVVA RLAAVRQEFE ARQRSSVTSR DTSKDPELDQ FMEAYYDMLV  180
KYREELTRPI QEALDFMRRI EAQLNMLTNA PVRIFNSDGG DDDNDDDLLL CLPLPNAVAW  240
KKKRKRLPES TSFVFIHFAI DSYEKCEGVA SSEEDQENSG GETELPEFDP RVEDRELKNH  300
LLRKYSGYLS SLKQELSKKK KKGKLPKEAR QKLLSWWELH YKWPYPSESE KVALAESTGL  360
DQKQINNWFI NQRKRHWKPS EDMQFMVMDG WGSLLSGPGC LPVFLMFKGT VLRLVTPCYF  420
IAV
Functional Description ? help Back to Top
Source Description
UniProtProbably binds to the DNA sequence 5'-TGAC-3'.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5266654e-83HQ526665.1 Gossypium herbaceum clone NBRI_B_2171 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017604206.10.0PREDICTED: homeotic protein knotted-1-like
SwissprotO041351e-160KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA0A1U8PFC80.0A0A1U8PFC8_GOSHI; homeobox protein knotted-1-like 2
TrEMBLA0A2P5X7560.0A0A2P5X756_GOSBA; Uncharacterized protein
STRINGGorai.009G223200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65662335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-123KNOTTED-like from Arabidopsis thaliana