PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_27662_BGI-A2_v1.0
Common NameF383_02703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 298aa    MW: 32562.9 Da    PI: 7.0763
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_27662_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like73.33.5e-231052143
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtl 43
                                kprl+WtpeLH+rFv+a++qLGG++kAtPk+++++m+++gLtl
  Cotton_A_27662_BGI-A2_v1.0 10 KPRLKWTPELHQRFVDAINQLGGPDKATPKSVMRVMGIPGLTL 52
                                79****************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-20852IPR009057Homeodomain-like
SuperFamilySSF466892.87E-9952IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-151051IPR006447Myb domain, plants
PfamPF002491.1E-51251IPR001005SANT/Myb domain
PfamPF143797.3E-2390136IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MNLVLSTDAK PRLKWTPELH QRFVDAINQL GGPDKATPKS VMRVMGIPGL TLLGKSLGNN  60
TDYKEIQSSN GNFIRDTSDG IHGQMNESLQ IPQALHMQME VQRKLHEQIE VQRHLQLRIE  120
AQGKYLQTVL KKAQETLAGY SSSSAGAELA RAELSQLVSM VNTGCTSSSF SELTEVGGSS  180
IIERKPMRGT TCSMGSSLTS SESSGRNDKA PLENGNICTQ NVELSLMDFL PEKKPLISCA  240
SNQANGKKRS VSKVSDGVCV EQPLAKRLEL PEEETGGCLR KSGFLELFDL NNQCHNDI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5789861e-101JX578986.1 Gossypium hirsutum clone NBRI_GE11130 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017618287.10.0PREDICTED: myb family transcription factor PHL8-like isoform X1
SwissprotF4I2743e-76PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A0B0PLN30.0A0A0B0PLN3_GOSAR; Myb family transcription factor APL
STRINGGorai.013G086300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-76G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]