PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_27417_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 799aa    MW: 88360.4 Da    PI: 6.7155
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_27417_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-096036401954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Cotton_A_27417_BGI-A2_v1.0 603 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 640
                                 664459******************************87 PP

2BELL104.57.1e-34463532372
                        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 +e q+kkakL+ + eeV++rYk y++q+q+v+ssFe vaglg+a pY+ lAlk+++r FrcL++ai +qi
  Cotton_A_27417_BGI-A2_v1.0 463 HEYQQKKAKLVYMHEEVCRRYKLYHQQMQMVVSSFESVAGLGAAIPYVPLALKTVARDFRCLRNAILDQI 532
                                 799*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.0E-46396530IPR006563POX domain
PfamPF075262.9E-41401528IPR006563POX domain
PROSITE profilePS5007112.212581644IPR001356Homeobox domain
SMARTSM003894.1E-8584648IPR001356Homeobox domain
CDDcd000861.01E-11584645No hitNo description
SuperFamilySSF466896.84E-17585651IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-27587648IPR009057Homeodomain-like
PfamPF059203.7E-18601640IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MDMSKFRPES HVAQQRLRDK LRVQQSSKLV QQLEDFPNNL EDGCSSVLPA LNPGLAHVRN  60
VRNDNLLYDP DVFSSDIIHV SSNSSVLPSQ RDTMLHQEMQ TAPENRQLLA EESSFPGMSQ  120
SNLSKFDGSS KVSGDPHDCG NWRGVDSQHN CDWMVGYASG LAVRESNQDH RFVGEVMSNN  180
ARILNSAYQD VQSTHPNPGS EIYSLERNLH FVSPSLYQNS LQDVVTTAQG LEVGSHEPQN  240
VREAAKGSRT DYCGNEANPL HFGNAGTWMN TPLGEHSQQW GAELGFLASK SSVELGAAAS  300
DATTQGLSLS LSSYPTPKIC GADPVQFTGN QYGSDGFLSK PGEFKELRDS KTSNMGHFFS  360
MQKSSSTCKA DGKSLQDAGG TSAYVHRQTI PLGPFTGYAT ILKNSRFLKP AQELLDEFCD  420
ISNSKPVKVC DTSEGIPGEV SACKESNSGA SATFYSSNES CKHEYQQKKA KLVYMHEEVC  480
RRYKLYHQQM QMVVSSFESV AGLGAAIPYV PLALKTVARD FRCLRNAILD QIKHVSRALG  540
EDLLSPTTGT SGSKGDINMS RLNCFGQKSG GVNMGFLEAQ QHSWRPQRGL PERSVAILRA  600
WLFEHFLHPY PTDTDKHMLA TQTGLSRNQV SNWFINARVR VWKPMVEEIH MLESKCLPEG  660
NQNSSKSEGK STSEGRISWP NDGQSINRSC VNALSDKQLA CADMLVADAH DLEHWNHEKR  720
SSMDFHIPTS MEGSLMGFAP YQQSRLENGG LGAVSLTLGL MHGVESAQQQ QRQQQQQYQQ  780
QEHHSRRQFG GHLIHDFAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-15590647158Homeobox protein Meis1
4xrs_B1e-15590647158Homeobox protein Meis1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9645391e-109JX964539.1 Gossypium hirsutum clone NBRI_TRANS-808 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017644467.10.0PREDICTED: BEL1-like homeodomain protein 2
TrEMBLA0A1U8PI330.0A0A1U8PI33_GOSHI; BEL1-like homeodomain protein 2
STRINGGorai.009G109300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143211520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.13e-87BEL1-like homeodomain 8