PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_27212_BGI-A2_v1.0
Common NameF383_19862
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 680aa    MW: 74905.1 Da    PI: 5.5293
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_27212_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.93.9e-094204571954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +++  LA+++gLt +qV +WF N R +
  Cotton_A_27212_BGI-A2_v1.0 420 FEHflHPYPKDSDKIMLARQTGLTRSQVANWFINARVR 457
                                 664459******************************88 PP

2BELL128.81.9e-41282353172
                        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 e+qelq+k +kLls+l+eVd+rYkqy++q+q+v+ssF+++ag+g+akpYt+lAl++iSrhFrcL+dai +q+
  Cotton_A_27212_BGI-A2_v1.0 282 EKQELQSKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAINGQV 353
                                 689******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-63205351IPR006563POX domain
PfamPF075261.0E-51211349IPR006563POX domain
PROSITE profilePS5007112.082398461IPR001356Homeobox domain
CDDcd000861.05E-12401462No hitNo description
SMARTSM003891.7E-9401465IPR001356Homeobox domain
SuperFamilySSF466895.56E-17402468IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-28404467IPR009057Homeodomain-like
PfamPF059201.3E-17418457IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MATYDTGSDN QKDTAPMIYF RESMPGSFPE APDLPGNAIM YMNSGSYLDA FAGNSQQQNN  60
CVEILAVEAS DSTPQQQEIL SNLGGSRVGD FGTWRDGRNE ILVMHPMDGT ASILRNGQNL  120
QGQGLSLSLG TQIPSGIQMT SIPYRNPNST FASFLSPNPT LTGEGGSRTS SCRDEQSRNA  180
EYVPPGFSGG NQNSNKGDLS AYGMSSTSRT IPNSKYLKAV QQLLDEVVNV RMALKQCNGE  240
KNQSSEDNQM KSSKEDDGGS KKMPSNQQEF SNNSPNQLSH AEKQELQSKL TKLLSMLDEV  300
DRRYKQYYHQ MQIVVSSFDV IAGCGAAKPY TALALQTISR HFRCLRDAIN GQVRATRKSL  360
GEQDTSENGK GVGITRLRYV DQQLRQQRAL QQLGMMQQHA WRPQRGLPES SVSILRAWLF  420
EHFLHPYPKD SDKIMLARQT GLTRSQVANW FINARVRLWK PMVEEMYKEE FADAEMDSNS  480
SSENVVKATK GDTRTSEDRG EDVQQSESSP AIERCDTRQL VDSKPNPVPS LVDMEGPVTG  540
AGFQYFTRGE AETEHMLLKL REEQRPNIDD SNLFPNAISH PDGDSDRIMA VAAAYQMSGF  600
GNFGNRSSVS LTLGLQHCEG GNIPISGGGH QDFVAMRGAD ICNPTASSVG ASETSDFECI  660
NPGNRQHGFS SSHLLHDFVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A4e-16407464158Homeobox protein Meis1
4xrs_B4e-16407464158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017637164.10.0PREDICTED: BEL1-like homeodomain protein 6
TrEMBLA0A0B0MEG80.0A0A0B0MEG8_GOSAR; BEL1-like homeodomain protein 6
STRINGGorai.008G031100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-140BEL1-like homeodomain 6