PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_26940_BGI-A2_v1.0
Common NameF383_24858
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 307aa    MW: 34620.5 Da    PI: 8.4809
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_26940_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.6e-322073255
                     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                prlrWtp+LH++F++a+++LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Cotton_A_26940_BGI-A2_v1.0 20 PRLRWTPQLHHCFLHAIDRLGGQHKATPKLVLQLMDVKGLTISHVKSHLQMYRS 73
                                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-301676IPR009057Homeodomain-like
PROSITE profilePS5129411.7511676IPR017930Myb domain
SuperFamilySSF466894.12E-151875IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-232073IPR006447Myb domain, plants
PfamPF002491.3E-72172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRCGRHNGA VRQYIRSKVP RLRWTPQLHH CFLHAIDRLG GQHKATPKLV LQLMDVKGLT  60
ISHVKSHLQM YRSMRSDYGR QVTSSTHERR QSFDDNHGFD GCVVPIEESC SHLIDNNPFP  120
PKRHGICETR VSNTCSFDDY KQTMDARKRI KQDNGDYVWD QTINYSHSLG QPLALSLPHD  180
LYSLNAFRSY SLLSLTQATK VEVEDPKRAH EQDAKLIERN IRRQEEDDGG GGGCELSLSL  240
SLSLQYHNTS STSETRSSEA FSSYLRSNYK DCWGSSSTST FSSSSSSSSV TRRSAINLDL  300
SIALCGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-182175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-182175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-182175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-182175357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017605173.10.0PREDICTED: putative Myb family transcription factor At1g14600
RefseqXP_017605174.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A0B0MKR60.0A0A0B0MKR6_GOSAR; Uncharacterized protein
STRINGGorai.009G329400.11e-180(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.13e-36G2-like family protein