PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_26053_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 321aa    MW: 36318.1 Da    PI: 9.1803
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_26053_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.5e-3251104255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 prlrWtpeLH +Fv+ave+LGG+e+AtPk +l+lm+++gL+++hvkSHLQ+YR+
  Cotton_A_26053_BGI-A2_v1.0  51 PRLRWTPELHLCFVRAVERLGGQERATPKLVLQLMNIEGLSIAHVKSHLQMYRS 104
                                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-2947105IPR009057Homeodomain-like
PROSITE profilePS5129412.91647107IPR017930Myb domain
SuperFamilySSF466892.87E-1548105IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-2351106IPR006447Myb domain, plants
PfamPF002497.9E-1052103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MHKINPLNLD EDEEADDGIS KTINSASPSN SSEKKETASS GVRPYVRSKT PRLRWTPELH  60
LCFVRAVERL GGQERATPKL VLQLMNIEGL SIAHVKSHLQ MYRSKKIDDK GQVVNNRHLL  120
GSVNYCSQNL RYQSMLQDQR VISDISWRAF AGNRINCRRR AGFCRSDMTK EVGSKARNEV  180
VYMNNNPIFS EQPVREIEGF QDIIDDCAEV QPILILPSFS NKWLGRGAER QVRVAKRKAV  240
DDEDLDLSLS LSTKMGQEVR RKTCNEEEAA NSNLSLSLSS PSKTEMYSLN VNMVSKRSNL  300
KEGHDSTRYL KLASTLDLTI S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1952106357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1952106357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1952106357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1952106357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017641173.10.0PREDICTED: uncharacterized protein LOC108482553
TrEMBLA0A1U8J9590.0A0A1U8J959_GOSHI; uncharacterized protein LOC107903224
STRINGGorai.009G112300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-42G2-like family protein