PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_25826_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 274aa    MW: 31182.9 Da    PI: 9.5211
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_25826_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.93.1e-25196245251
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                 +r+ W+p+LH+rFve ++ LGG  +AtPk+i+e+m+v+gLt+++vkSHLQ
  Cotton_A_25826_BGI-A2_v1.0 196 NRRSWSPQLHARFVETLHILGGMYEATPKQIREMMNVDGLTNDQVKSHLQ 245
                                 799*********************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.99E-13193247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-20194245IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-20195249IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MASSSNSLGL KLSLKPTYVP KTITDLMKDL PNIENETDKL AVLSDYISQH EEELNSIAAL  60
RGHLPQCMLL LMEALVTLRQ EFLKIKNGMV ASKEGDTDMV LKENSGMKRK RCEKMLEAER  120
VPNSKCDFKG KGVMMNSSPP HHPSHHKHPK TFRDFVQASN QNPSSNGGGG LNLRADNRTL  180
LNYKHKPLTQ PIWKNNRRSW SPQLHARFVE TLHILGGMYE ATPKQIREMM NVDGLTNDQV  240
KSHLQVDFQT YFIYTLRFLK IDKSFFGIQD LDGC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6224502e-43JX622450.1 Gossypium hirsutum clone NBRI_GE69182 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017645970.10.0PREDICTED: putative two-component response regulator ARR20
TrEMBLA0A0B0PYW00.0A0A0B0PYW0_GOSAR; Uncharacterized protein
STRINGGorai.001G206600.11e-170(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15410716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-18G2-like family protein