PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_25753_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family WRKY
Protein Properties Length: 504aa    MW: 54736.6 Da    PI: 6.1361
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_25753_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.15e-25185241259
                                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                 +D ynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+ei+++g H he
  Cotton_A_25753_BGI-A2_v1.0 185 SDVYNWRKYGQKQVKSPKGSRSYYKCTFSDCQAKK-IECSDDTGHVIEIVNKGMHSHE 241
                                 7********************************98.*********************8 PP

2WRKY98.35e-31367423359
                                 -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                        WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                 Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++++itY+g H+h+
  Cotton_A_25753_BGI-A2_v1.0 367 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTNAIIITYKGVHDHD 423
                                 9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-19176243IPR003657WRKY domain
SuperFamilySSF1182907.19E-19182243IPR003657WRKY domain
SMARTSM007741.3E-22184242IPR003657WRKY domain
PROSITE profilePS5081116.088185243IPR003657WRKY domain
PfamPF031064.7E-16186240IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-31350425IPR003657WRKY domain
PROSITE profilePS5081131.904360425IPR003657WRKY domain
SuperFamilySSF1182908.76E-27361425IPR003657WRKY domain
SMARTSM007748.6E-35365424IPR003657WRKY domain
PfamPF031062.6E-23367422IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MAETESQALP TKRHHHHQND DSEGQEDDDE EEEEEEDGLE NEEEEEGASR VSESQGAGAA  60
PPSDDAGLKH SQLDTLPNDD PPEGLQVNST SESKEGAEFK EKVNTAEQEV SPSLAVLSPE  120
APTSVSQQAL TSVTQGISSA PTPTLQGQSL YDQKVNGATV PKAKQQKSYN LKMVSVVSIV  180
KTPVSDVYNW RKYGQKQVKS PKGSRSYYKC TFSDCQAKKI ECSDDTGHVI EIVNKGMHSH  240
EPPRKNNFTR ESKIVSSAAR ASHNIQPIRI FNDSDPSTSS KESVPETTVN PERKGLFSSG  300
SDGNGDVQVK EELMSEPETK KKASIPVSFS LPFMKKGNTV CSDSVPKTRK KPRFVVHAAG  360
DVGISGDGYR WRKYGQKMVK GNPNPRNYYR CTSAGCPVRK HIETAVDNTN AIIITYKGVH  420
DHDMPVPKKR HGQPIAPLVA AAAPASMNNL QHKKTDGGQS PVTSTQWSVG TEGELTGEAL  480
DLGGEKAIES ARTLLSIGFE IKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-26353425274WRKY transcription factor 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6697680.0KF669768.1 Gossypium hirsutum WRKY transcription factor 82 (WRKY82) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449854.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595831e-130WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0D2SR030.0A0A0D2SR03_G
STRINGVIT_11s0037g00150.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-124WRKY DNA-binding protein 32