PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_25525_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 342aa    MW: 39139.2 Da    PI: 9.7455
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_25525_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-3371124255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 prlrWtp+LH++Fv+ave+LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR+
  Cotton_A_25525_BGI-A2_v1.0  71 PRLRWTPDLHQCFVHAVERLGGEDRATPKMVLQIMDVKGLTISHVKSHLQMYRS 124
                                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.31567127IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-3267125IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1569125IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-2571125IPR006447Myb domain, plants
PfamPF002498.7E-872123IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MKRVDVGSCW LKGCCSSSSS LDDSGGISVY SPSPSMMRVM RRRHHKDDNL QLPEISLKSP  60
IVRPYVRSKM PRLRWTPDLH QCFVHAVERL GGEDRATPKM VLQIMDVKGL TISHVKSHLQ  120
MYRSTKHEQM IQEAATASRR NEKVLELMNC PQNQQFKDQV RPYNLGLGIE GMPSCTIYRQ  180
PQWYIYLYVF VYLYLYPVLL YLHLILRSQK KRVSLNLSSE NVYIETFLHI CRNGNKVSNQ  240
LSYGELTNKG SEQRSSTSYI IFKDLLKSCT IPENREKVNV GQHGGADWKC NHQKLVKLGD  300
HSQASDCSIC RSLKSKVSQK MSRHGKAETL GLNDVSLELS LA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1972127459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1972127459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1972127459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1972127459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1972127459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1972127459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1972127459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1972127459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5784951e-115JX578495.1 Gossypium hirsutum clone NBRI_GE10535 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017646457.10.0PREDICTED: uncharacterized protein LOC108486757
RefseqXP_017646458.10.0PREDICTED: uncharacterized protein LOC108486757
RefseqXP_017646459.10.0PREDICTED: uncharacterized protein LOC108486757
TrEMBLA0A1U8PWB50.0A0A1U8PWB5_GOSHI; uncharacterized protein LOC107963440
STRINGGorai.010G181100.11e-179(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.13e-33G2-like family protein