PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_24772_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 294aa    MW: 33294.1 Da    PI: 5.8032
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_24772_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.72.2e-3910108199
                      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilkl 83 
                                 aCaaCk++rrkC ++C lapyfpa+q+k f+n+hklFG+sn++k+l++l+++++ +am+s+ y+A++r r PvyG++gvi++l
  Cotton_A_24772_BGI-A2_v1.0  10 ACAACKYQRRKCIPECLLAPYFPADQTKVFQNAHKLFGVSNIVKILRSLDPSQHAEAMRSIKYQANVRDRFPVYGCLGVIRQL 92 
                                 7********************************************************************************** PP

                      DUF260  84 qqqleqlkaelallke 99 
                                   q++ l++e++++ +
  Cotton_A_24772_BGI-A2_v1.0  93 YYQIQMLEEEMHTVLT 108
                                 **********998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.2749110IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3710106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTLKGGATSA CAACKYQRRK CIPECLLAPY FPADQTKVFQ NAHKLFGVSN IVKILRSLDP  60
SQHAEAMRSI KYQANVRDRF PVYGCLGVIR QLYYQIQMLE EEMHTVLTQL EMYRQHHHHQ  120
QQQHQHQHQI SSMADDVISQ LELGMAPSNN ALPLFNQVTH QPYTMQNTYS SSDIDSPPKD  180
NVENNSLWIQ HLFLDTNNHG TSNNDSPIAI QSQLLVPNSE PLADTQHQVV QDYDEIHPFF  240
DSIDDRQSYI DTKDAEDSSS SEESLKETTQ LMVGNVGSKD LKNAAACFSL TSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-3161137114LOB family transfactor Ramosa2.1
5ly0_B4e-3161137114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3933921e-57GQ393392.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0357 SSR marker CGR5281 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016667688.10.0PREDICTED: LOB domain-containing protein 27-like
RefseqXP_017641435.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS66e-59LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A1U8HUQ70.0A0A1U8HUQ7_GOSHI; LOB domain-containing protein 27-like
STRINGGorai.003G070700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-60LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]