PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_24280_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 221aa    MW: 25115.5 Da    PI: 9.358
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_24280_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.9e-3255108255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 prlrWtpeLH +Fv+ave+LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Cotton_A_24280_BGI-A2_v1.0  55 PRLRWTPELHLSFVRAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 108
                                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-3051109IPR009057Homeodomain-like
PROSITE profilePS5129411.751111IPR017930Myb domain
SuperFamilySSF466893.23E-1553109IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-2255110IPR006447Myb domain, plants
PfamPF002499.8E-1056107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MLMKKNPLNL YDEDEEGDDG TKARDGASSS NSIVEECEKK ASPNGVRHYV RSKMPRLRWT  60
PELHLSFVRA VERLGGQERA TPKLVLQLMN IKGLSIAHVK SHLQMYRSKK INDQGKDDYL  120
PQNLWHQSTL HDHQRVISQQ PVNEMVHACE SNGAQIQPML MYMHPSFANK WPGKGAERQG  180
MSKRKPLDED LDLSLSLSTK LRRKTSNEEE AANSNLSLSL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1856110458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1856110458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1856110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1856110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1856110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1856110357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1856110458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1856110458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1856110458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1856110458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1856110458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1856110458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017618792.11e-155PREDICTED: putative two-component response regulator ARR20
TrEMBLA0A1U8JG561e-151A0A1U8JG56_GOSHI; putative two-component response regulator ARR20
STRINGGorai.004G233300.11e-148(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-43G2-like family protein