PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_23834_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 361aa    MW: 39327.9 Da    PI: 6.1205
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_23834_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59.2e-11162214557
                                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                 kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +    
  Cotton_A_23834_BGI-A2_v1.0 162 KRAKRIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTT 214
                                 9****************************************999877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-17158222IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622160223IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.03E-11162213No hitNo description
PfamPF001702.7E-9162211IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.4E-11162216No hitNo description
CDDcd147031.34E-24163212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MQDPPSLKPN PDPPVPSNAS STTPSFPNPT TFRGSYHRRA QSEVQFRIPD DLDLVSDPFE  60
GMGSEDDLFC SYMDIEKLGG SSKGAEEGRG ATGSSTAGSA HNPKGDEISG GSAGMGEKTN  120
EGGKGRHRYS NSVDGCSLME SIEAKKAMAP DKLAELWTID PKRAKRIIAN RQSAARSKER  180
KARYISELER KVQTLQTEAT TLSAQLTLFQ RDTTGLTTEN TELKLRLQAM EQQAQLRDAL  240
NEALKKEVER LKMATGEMST PTDNFNLGMH HIPFTQSSFF PPQPRQVETQ NMQMPPFHPL  300
QSNMLASNQS MVAASGPHAF ADMMQQDPLG RLQGLDISSR DSHLVKSEGP SISAGESSGT  360
L
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017646609.10.0PREDICTED: transcription factor RF2b-like
SwissprotO228731e-118BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A1U8KEP50.0A0A1U8KEP5_GOSHI; transcription factor RF2b
STRINGEOY201250.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-116bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]