PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_23133_BGI-A2_v1.0
Common NameF383_22808
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 535aa    MW: 59870.5 Da    PI: 5.7679
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_23133_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.2e-27302354255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                  +++WtpeLH++Fv+av+qL G+++A+P++ilelmkv+gLt+++v+SHLQkYR+
  Cotton_A_23133_BGI-A2_v1.0 302 LKVDWTPELHKKFVQAVDQL-GIDQAIPSRILELMKVEGLTRHNVASHLQKYRM 354
                                 5899****************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.1E-1316157No hitNo description
SuperFamilySSF521726.4E-1316135IPR011006CheY-like superfamily
PROSITE profilePS5011017.41319132IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.47E-721131No hitNo description
PROSITE profilePS5129415.074298357IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-26299357IPR009057Homeodomain-like
SuperFamilySSF466894.3E-18300357IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-24301355IPR006447Myb domain, plants
PfamPF002491.3E-7304353IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MVCTANDLST WKDFPKGLKI LLLDGDTNSA NELKSKLEAM DYIVYAFHDE NEAILAVSSR  60
PESFHVAIVE VSTDINNGSF KFLETAKDLP TIMTSNIHCI GTMMKCIALG AVEFLKKPLS  120
EDKLRNIWQH VVHKAFNTGG NDLTESLKPV KESVVSMLQQ QPENLKPKNE DSEKTEDASM  180
IHENDSEPPA GNDKYPAPST PQLEQGGRLL DDRDCQDHTH CSIEKESGEQ DGETESVETT  240
SGNTTATGGQ PQGPSETNVK EEDDSVDGTM GESPQNRVDS KGSDVVAEKP SSCPDKANRK  300
KLKVDWTPEL HKKFVQAVDQ LGIDQAIPSR ILELMKVEGL TRHNVASHLQ KYRMQRRHML  360
PKEDDRRWLQ RPQMQRICNY PHKPIMAFPP YHHVPVGPVY PMWGAPSHPP TIQMWGTQGY  420
PPWQPTESWH WKPYPGVHAD AWGCPVMPPP QGYFSTFPQN ASGFQPCNVD KRNGMPQTLV  480
EHHPEEEVID KMVKEAINKP WLPLPLGLKP PSTDSVLAEL YRQGISTVPP HINAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-16299354358ARR10-B
5lxu_A2e-16306354654Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5816581e-105JX581658.1 Gossypium hirsutum clone NBRI_GE14330 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017638694.10.0PREDICTED: two-component response regulator-like APRR2 isoform X2
SwissprotQ6LA431e-143APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A0B0MN380.0A0A0B0MN38_GOSAR; Two-component response regulator-like APRR2
STRINGGorai.003G180100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57462747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-143ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]