PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_22883_BGI-A2_v1.0
Common NameF383_31328
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 383aa    MW: 42599.7 Da    PI: 7.9692
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_22883_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31212266155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 k+r+rWt++LH++Fv++v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Cotton_A_22883_BGI-A2_v1.0 212 KTRIRWTQDLHDKFVDCVKRLGGAEKATPKAILKLMDTEGLTIFHVKSHLQKYRI 266
                                 68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.441209269IPR017930Myb domain
SuperFamilySSF466891.79E-16210266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-28211267IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-24212267IPR006447Myb domain, plants
PfamPF002494.1E-8216265IPR001005SANT/Myb domain
PfamPF143791.5E-21294340IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MNTQKLDCQE NVGQNLGFNR DCNFEYVGFQ QPWNMATPMV DGTVSHHPKS SSSSTIMGGF  60
QTPGAAFYAT ERCMGFPQYG SSSQGAATSF CSQYNKLCNS QLPSFHASGD NFSLQSLMKS  120
QIFCNQYQKS SDKSCTTTED PSHDLSNLLG TNAATLPNHF SVPFRGNQDQ GAYCNSRGSS  180
PAKLSFFLQE KQSSSGSFSV SPSSTGTVLT SKTRIRWTQD LHDKFVDCVK RLGGAEKATP  240
KAILKLMDTE GLTIFHVKSH LQKYRIAKYM PDSAQGKSEK RNDLTQIDVK TGLHLTEALQ  300
LQLDVQRRLH EQLEIQRNLQ LRIEEQGRQL KMMIDQQQKT SESLLKNQEF NISPFDPSFS  360
FQDVVETSIP ESLGTGNLSS KIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-22212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-22212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-22212269158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-22212269158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-22212269158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-22212269158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-22212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-22212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-22212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-22212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-22212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-22212269259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017622420.10.0PREDICTED: myb family transcription factor PHL5-like
SwissprotQ0WVU32e-77PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLA0A0B0N0W30.0A0A0B0N0W3_GOSAR; Myb family transcription factor APL
STRINGGorai.002G225400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.17e-76G2-like family protein