PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_22674_BGI-A2_v1.0
Common NameF383_19282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 642aa    MW: 69916 Da    PI: 7.4822
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_22674_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-094434801954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  Cotton_A_22674_BGI-A2_v1.0 443 FEHflHPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 480
                                 554459******************************88 PP

2BELL107.11.1e-34312380472
                        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 e ++kk++L+s+l+eV++ Ykqy++q+q+v++sFe vaglg+a+pY++lAlka+S+hFrcLk+ai++q+
  Cotton_A_22674_BGI-A2_v1.0 312 ESRRKKSRLISMLDEVYRSYKQYYQQIQAVVASFEYVAGLGNAAPYANLALKAMSKHFRCLKNAITDQL 380
                                 7899**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.2E-53247378IPR006563POX domain
PfamPF075262.8E-39252377IPR006563POX domain
PROSITE profilePS5007112.098421484IPR001356Homeobox domain
SMARTSM003893.4E-10424488IPR001356Homeobox domain
CDDcd000864.33E-13424485No hitNo description
SuperFamilySSF466895.56E-17426490IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27427488IPR009057Homeodomain-like
PfamPF059201.2E-18441480IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MAEGFEPYHV PQQSRRDKLR IVAQNHSACV ESTAVTLSGC SGLLPLYEAS LLSSDLLTCA  60
ANASASHDFH HHQANQLSAS ASGKNSSLVC GVKGVNSMGF VGGVVNGSSS ASHHHPYLDG  120
QSSLPVNPSS IHDMNNSPFL YTPQNLQTIR DFDQSYNSGG EVVVYKPEPL SLNHESSATA  180
QALSLSLSSH NTHQNNLPLE LNLQRYGSAI YSDKVTDSGY VVPSIIRGSA STSNEVSRGS  240
LPLGPFTGYA SILKGSRFLR PAQMLLEELC DVGRGLYAEK MTPDSSLMDP SLQNLSGTGI  300
IDDSLSGGDG GESRRKKSRL ISMLDEVYRS YKQYYQQIQA VVASFEYVAG LGNAAPYANL  360
ALKAMSKHFR CLKNAITDQL QFINKPHGQT SPGKDEGPMF GNTERSLYNR AVHNAGFHEH  420
QPVWRPQRGL PERAVTVLRA WLFEHFLHPY PTDTDKLMLA KQTGLSRSQV SNWFINARVR  480
LWKPMVEEIH MLEQAQKNSQ KEARNPNKPS DHLSSANSIA PENPSTSFQR AQDTPSKRTR  540
SEPLSDIPLG SEPHNLTYNS LSSHPHVGMG VSMAGGSNGV SLTLGLHQNN GISLSEPFPF  600
NAAQRFGLGL SSEGYVIGGY ESQNRHFGRD VMGGQLLHDF VG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16430487158Homeobox protein Meis1
4xrs_B2e-16430487158Homeobox protein Meis1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate. {ECO:0000269|PubMed:12874117, ECO:0000269|PubMed:12897247, ECO:0000269|PubMed:13678595, ECO:0000269|PubMed:15019989, ECO:0000269|PubMed:15120075, ECO:0000269|PubMed:15155890, ECO:0000269|PubMed:16741748}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017612794.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-121BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A0B0MEP50.0A0A0B0MEP5_GOSAR; BEL1-like homeodomain protein 9
STRINGGorai.012G108300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56882746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-121TALE family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Pabón-Mora N,Wong GK,Ambrose BA
    Evolution of fruit development genes in flowering plants.
    Front Plant Sci, 2014. 5: p. 300
    [PMID:25018763]
  3. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]
  4. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  5. Bencivenga S,Serrano-Mislata A,Bush M,Fox S,Sablowski R
    Control of Oriented Tissue Growth through Repression of Organ Boundary Genes Promotes Stem Morphogenesis.
    Dev. Cell, 2016. 39(2): p. 198-208
    [PMID:27666746]
  6. Sehra B,Franks RG
    Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development.
    Front Plant Sci, 2017. 8: p. 1712
    [PMID:29085379]
  7. Simonini S,Stephenson P,Østergaard L
    A molecular framework controlling style morphology in Brassicaceae.
    Development, 2018.
    [PMID:29440299]