PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_21862_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 83aa    MW: 9370.89 Da    PI: 10.7505
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_21862_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.81.2e-121151343
                                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                i n+s r +t+ kR +g  KK  EL +LC++e+  ii s++
  Cotton_A_21862_BGI-A2_v1.0 11 ITNDSARRTTYKKRSKGQVKKVRELTTLCGIEAFAIINSPD 51
                                89***********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.01E-16151IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.334149IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-12155IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-6323IPR002100Transcription factor, MADS-box
CDDcd002663.23E-16351No hitNo description
PfamPF003191.7E-121151IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MSRKKIKLDY ITNDSARRTT YKKRSKGQVK KVRELTTLCG IEAFAIINSP DFGSQAEVRM  60
AVPRGCPTLA VRVQEAAHFE TKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016670153.12e-30PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_017635023.12e-30PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A1U8I1R84e-29A0A1U8I1R8_GOSHI; agamous-like MADS-box protein AGL80
STRINGGorai.013G210300.13e-29(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-18M-type_MADS family protein