PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_20433_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 430aa    MW: 47294.1 Da    PI: 8.3837
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_20433_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.63.9e-30212267156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k r++W+p+LHerFv+a++ LG +++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Cotton_A_20433_BGI-A2_v1.0 212 KSRRCWSPDLHERFVNALQMLGVHQVATPKQIRELMKVEGLTNDEVKSHLQKYRLH 267
                                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.865209269IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-27210270IPR009057Homeodomain-like
SuperFamilySSF466895.89E-17211270IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-26212267IPR006447Myb domain, plants
PfamPF002493.8E-7214265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MNGQTQKLEH VLSRLEEERL KIDAFKRKLT LCMQLLANVM KASRQQLHAY RANQGSKAIF  60
EEFIPLNNSH SENTKRLENM SEKANLMITE QLWRQTGTEM KSRSSIASPA KADIDFNVGP  120
KLDLDTKVRN GGAFLPLSKD RNSSSSCAGP TLQPLPDLKL ASISKDMEEN KCSKAENDNL  180
GKVGNGGVLI EQGKGSSNTI DGQTTTSQPD RKSRRCWSPD LHERFVNALQ MLGVHQVATP  240
KQIRELMKVE GLTNDEVKSH LQKYRLHTRR PNLSPQPAGP PTSQLVVLGG IWVPSEYATA  300
VANTNSAALT LYGAHHPPLA LHLPPHFCAS PVPQEFYTAT TIATPALSQQ LLHHQLHYKA  360
NSQAHSSPES DVKRTGNHSE SIEDNKSESS SRKGESGDNG SDRDQRKGLG ALTLGEEGEE  420
SNGCDITLKF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6051724e-43JX605172.1 Gossypium hirsutum clone NBRI_GE44715 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017644453.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A1U8PWH30.0A0A1U8PWH3_GOSHI; uncharacterized protein LOC107963542
STRINGGorai.009G022100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-90G2-like family protein