PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_19739_BGI-A2_v1.0
Common NameF383_09818
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 626aa    MW: 69343.8 Da    PI: 5.6199
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_19739_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-093734101954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  Cotton_A_19739_BGI-A2_v1.0 373 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 410
                                 664459******************************88 PP

2BELL126.68.9e-41235306172
                        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 erqelq+k +kLls+l+eVd+rYkqy++q+q+v+ssF+a ag+g++kpYt+lAl++iSrhFrcL+dai +q+
  Cotton_A_19739_BGI-A2_v1.0 235 ERQELQSKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDALAGCGASKPYTALALQTISRHFRCLRDAINGQV 306
                                 79*******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.8E-63158304IPR006563POX domain
PfamPF075261.1E-51164302IPR006563POX domain
PROSITE profilePS5007112.163351414IPR001356Homeobox domain
SMARTSM003891.0E-9354418IPR001356Homeobox domain
CDDcd000868.64E-13354415No hitNo description
SuperFamilySSF466892.65E-17355421IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-29357420IPR009057Homeodomain-like
PfamPF059204.2E-18371410IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MASYYTGSDN QRDTAPMIYL RESMPGSFLE GPVLPGNTML YMSSGSFSDA FAGNSQQQNN  60
CVEIPTVEAA TSQQQQILSN LDCSREQDFS GWRDGRNEMP AMHLMGSTSG IGHDGQNLQG  120
QGLSLSLGTQ IPYRNPSSGF PSGNQESNKG ELSAFGMSSM VRTIPNSKYL KAAQQLLDEV  180
VNVQKALKQP DGEKNRNSLE NRVKSSKEDD GGSKNVPANQ QESSINSPKE LSHAERQELQ  240
SKLTKLLSML DEVDRRYKQY YHQMQIVVSS FDALAGCGAS KPYTALALQT ISRHFRCLRD  300
AINGQVQATR TSLGELDASE NSKELRITRL RYVDQQLRQQ RALQQFGMMQ QHAWRPQRGL  360
PESSVSILRA WLFEHFLHPY PKDSDKIMLA RQTGLTRSQV SNWFINARVR LWKPMVEEMY  420
KEEFADAEMD SNSSSDNAVK AATKGDTMTS EDRGEDLQQS GSSSATERCS NGQLMDSKSE  480
NVHDADISGS TIGAGFLNAS CGEAETEYVL QKLREEQRLT IDDSNIFPDA SVPLDGGSHR  540
FMGASGYNVS ELGRFGSGVS LTLGLQHYED GSISMSGGSH HQNFVAMRGD DMYNHIPTET  600
GDFECMNPSN RQHRLSSSKL LHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16360417158Homeobox protein Meis1
4xrs_B1e-16360417158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017619867.10.0PREDICTED: BEL1-like homeodomain protein 6
SwissprotO656851e-151BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLA0A0B0NYR70.0A0A0B0NYR7_GOSAR; BEL1-like homeodomain protein 6
STRINGGorai.013G034600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-140BEL1-like homeodomain 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Cassan-Wang H, et al.
    Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis.
    Front Plant Sci, 2013. 4: p. 189
    [PMID:23781226]