PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_19416_BGI-A2_v1.0
Common NameF383_13523
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 408aa    MW: 45441.9 Da    PI: 7.4597
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_19416_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1049e-33260315156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Cotton_A_19416_BGI-A2_v1.0 260 KQRRCWSPELHRRFVKALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 315
                                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.838257317IPR017930Myb domain
SuperFamilySSF466893.05E-18258318IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-29259318IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-27260315IPR006447Myb domain, plants
PfamPF002494.0E-8262313IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGLVPPELSL DFRPNFVPKT ITNFLRELSL IGNVSDKVSK LDAFVKGLEE EMKKIDAFKR  60
ELPLCMLLLN DAILVLKEES TQCMARNVEP VLEEFIPLKN KEEDNHSEED GSLITTKKEE  120
DCNNDCNNNK DKKNWMSSVQ LWNIDDDYCS PDHKLDTKRN DEDPCKSRGG GGRGFMPFKA  180
NLGFAVRKED KQEVPVHGLT LSTPGIKNLK EESSSTGSRS SCSRAVTFSA TNARTSFRSA  240
PPVGLSNHLQ QHQQQQSGRK QRRCWSPELH RRFVKALQQL GGSQVATPKQ IRELMQVDGL  300
TNDEVKSHLQ KYRLHTRRLP ATTTTSTPAN QSGLVLGGGH AWMCQDQFGE SSKGSSSQSG  360
SPQGPLQLAT NTGGTSTTGC ESMEDDEDAK SECYSWKSHD QKPRKNNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14260313154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14260313154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14260313154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14260313154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9646122e-60JX964612.1 Gossypium hirsutum clone NBRI_TRANS-881 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017616379.10.0PREDICTED: myb family transcription factor EFM-like isoform X1
TrEMBLA0A0B0NDW00.0A0A0B0NDW0_GOSAR; Putative transcription factor GLK1
STRINGGorai.013G040600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145351021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-44G2-like family protein