PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_18479_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 289aa    MW: 32991.9 Da    PI: 5.2553
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_18479_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.3e-092332652355
                                 SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                    Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                 +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  Cotton_A_18479_BGI-A2_v1.0 233 PYPTEEEKLKLSEITGLDQKQINNWFINQRKRH 265
                                 8*****************************885 PP

2ELK35.81.7e-12185206122
                         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                 ++K +L+rKYsgyL++L++EF+
  Cotton_A_18479_BGI-A2_v1.0 185 DIKGMLMRKYSGYLCNLRKEFL 206
                                 58*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.9E-215599IPR005540KNOX1
PfamPF037904.3E-205798IPR005540KNOX1
SMARTSM012568.0E-26103154IPR005541KNOX2
PfamPF037912.3E-25106153IPR005541KNOX2
PROSITE profilePS5121310.057185205IPR005539ELK domain
PfamPF037894.8E-8185206IPR005539ELK domain
SMARTSM011882.9E-5185206IPR005539ELK domain
PROSITE profilePS5007111.661205268IPR001356Homeobox domain
SuperFamilySSF466891.75E-18207275IPR009057Homeodomain-like
SMARTSM003892.8E-12207272IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.4E-27210270IPR009057Homeodomain-like
CDDcd000866.01E-13217269No hitNo description
PfamPF059201.1E-16225264IPR008422Homeobox KN domain
PROSITE patternPS000270243266IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEDLDRLDDR TVSSSNDSAR VNNNLAATVT TTGFHSPVHH LLQFDHQAAD TDMPDVIKTQ  60
IANHPRYPDL VSAHIECRKV GAPPELASLL EEIGRENHHP ISGCSEIGAD PELDDFMESY  120
CDILHKYKEE LSKPFDEATT FLSNIESQLS NLCKGALTKT LDYGSDEACE SSGWEAEAYE  180
SGQEDIKGML MRKYSGYLCN LRKEFLKKSK KGKLPKDARM VLLHWWNNHY RWPYPTEEEK  240
LKLSEITGLD QKQINNWFIN QRKRHWKPSE DMKFALMEDF AGNINGGPT
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5831689e-65JX583168.1 Gossypium hirsutum clone NBRI_GE16149 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017625687.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP292e-91KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A1U8I8F00.0A0A1U8I8F0_GOSHI; homeobox protein knotted-1-like 1
STRINGGorai.004G236400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-80KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Park SH, et al.
    A Ds-insertion mutant of OSH6 (Oryza sativa Homeobox 6) exhibits outgrowth of vestigial leaf-like structures, bracts, in rice.
    Planta, 2007. 227(1): p. 1-12
    [PMID:17624547]