PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_17531_BGI-A2_v1.0
Common NameF383_20210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 348aa    MW: 40197.7 Da    PI: 7.9062
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_17531_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61.1e-3179132255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 prlrWtp+LH++Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Cotton_A_17531_BGI-A2_v1.0  79 PRLRWTPDLHHSFVRAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 132
                                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.64975135IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2975133IPR009057Homeodomain-like
SuperFamilySSF466891.51E-1478133IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-2279134IPR006447Myb domain, plants
PfamPF002496.3E-980131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MIEMHDEEQG EDVCAMPSRS RKCSSFDLND EAGSERDCIG ETSVEEEIEN ITEGSSSNNN  60
NGNGNDRRRV RQYVRSKLPR LRWTPDLHHS FVRAVERLGG QERATPKLVL QLMNVRGLSI  120
AHVKSHLQMY RSKKLDEAGQ VLSQSKTAIQ GKGEFGSLLC QAITTFSPHH YHQQQHFRME  180
NGGIVLASES LDGSDTTFKA NFPRHHQFPN SFISKTFGQE NGFYIQNQIH GTGPIRAMAS  240
RFLEEKRWHP FERISNRWKV NGNMYKDMQS QSHCFWQRSS SDEDKHEPLT KFSSCRTEFE  300
WNQDKVLKDR ERLPDLQLRL SQRNGKFDEE KNNHCKGTHE ISTQLSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1880134357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1880134357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1880134357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1880134357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6323601e-155AY632360.1 Gossypium hirsutum BAC 106I22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017649741.10.0PREDICTED: uncharacterized protein LOC108489596
TrEMBLA0A0B0MAH00.0A0A0B0MAH0_GOSAR; Uncharacterized protein
STRINGGorai.011G039000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-37G2-like family protein