PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_17004_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family B3
Protein Properties Length: 588aa    MW: 66219.5 Da    PI: 8.6208
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_17004_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.83.5e-17797299
                                EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                          B3  2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86
                                fkv   +d+ +sg l +p+kfa+++g+    s  + ++ ++g+ We+++  ++++g+++l++GW++F++   ++ g f+vF+++g
  Cotton_A_17004_BGI-A2_v1.0  7 FKVV-LEDTIRSGKLEIPRKFARDYGNH--LSNPVFIKVPNGEIWELEF--TNSGGKMWLQDGWQNFAEHYSVEPGHFLVFRYEG 86
                                4444.489999**************866..7778***************..********************************99 PP

                                SSEE..EEEEE-S CS
                          B3 87 rsefelvvkvfrk 99
                                +  f  +  +f++
  Cotton_A_17004_BGI-A2_v1.0 87 HCHF--HAIIFDR 97
                                8888..7777765 PP

2B351.51.8e-162123051098
                                 HHHT.....T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE.....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                          B3  10 vlks.....grlvlpkkfaeehggkkeesktltledesgrsWevkliy...rkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                                 + ++     ++l +p++f + + +k+++   ++l d++g+sW  k+     +++++ + l +GW  Fv++++L++gD++ F+l
  Cotton_A_17004_BGI-A2_v1.0 212 YVSHnpkhsCILGIPREFSRLF-LKQNG--NVVLCDSNGKSWAAKYATslgSNQRSYVRLCNGWGAFVRDKNLQVGDVCAFEL 291
                                 3333355569********9555.55444..6***************776655555558899********************** PP

                                 -SSSEE..EEEEE- CS
                          B3  85 dgrsefelvvkvfr 98 
                                 ++ ++ +++v++f+
  Cotton_A_17004_BGI-A2_v1.0 292 INCKQISFKVSIFE 305
                                 97688888888886 PP

3B349.95.7e-16356453297
                                 EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                          B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy..rkksgryvltkGWkeFvkangLkegDfvvF 82 
                                 + v +++++ +++ l+++++fa++h ++  +s+++ l  ++g+sW  k+     +++++  +  GWk Fv++n+L+ gD++v+
  Cotton_A_17004_BGI-A2_v1.0 356 LVVVLRPSYIRTDALCISNHFARKHFESDLTSVDVNLCLSNGKSWPAKYLRrsIGNPNGK-ICHGWKAFVNDNNLQPGDVCVL 437
                                 56667788888889***********7777899*****************44344444444.556******************* PP

                                 EE-SS.SEE..EEEEE CS
                          B3  83 kldgr.sefelvvkvf 97 
                                 +++++ ++ +++v +f
  Cotton_A_17004_BGI-A2_v1.0 438 EMTNHaTKISFKVIIF 453
                                 *886556666666655 PP

4B343.17.4e-145005841097
                                 HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                          B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                                 +lk++r  +p  f+e++ +++   ++ ++   ++rsW vk+  + + ++  +t+GW eF+++n L+egD++v +ld  + + l
  Cotton_A_17004_BGI-A2_v1.0 500 HLKEKRAGIPFGFVEQYLKPN---METVILKVENRSWPVKIASNPQNRQARFTNGWIEFARENFLREGDICVYELDAVKHGLL 579
                                 56677899*********6553...4566666788*******99999999**************************98888877 PP

                                 EEEEE CS
                          B3  93 vvkvf 97 
                                 +v + 
  Cotton_A_17004_BGI-A2_v1.0 580 NVCIS 584
                                 77775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.1E-22498IPR015300DNA-binding pseudobarrel domain
CDDcd100171.10E-20496No hitNo description
SuperFamilySSF1019361.35E-224105IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.648598IPR003340B3 DNA binding domain
SMARTSM010196.7E-16698IPR003340B3 DNA binding domain
PfamPF023622.3E-14796IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.4E-22195305IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-21198304IPR015300DNA-binding pseudobarrel domain
CDDcd100172.08E-19202304No hitNo description
SMARTSM010198.8E-12204307IPR003340B3 DNA binding domain
PROSITE profilePS5086313.169208307IPR003340B3 DNA binding domain
PfamPF023621.4E-13218305IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-20349455IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.63E-19349454IPR015300DNA-binding pseudobarrel domain
CDDcd100172.14E-19354454No hitNo description
PROSITE profilePS5086312.407355456IPR003340B3 DNA binding domain
SMARTSM010199.6E-13355456IPR003340B3 DNA binding domain
PfamPF023625.5E-15355454IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.0E-18485585IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.18E-15485585IPR015300DNA-binding pseudobarrel domain
CDDcd100172.27E-15490585No hitNo description
PROSITE profilePS5086312.999491587IPR003340B3 DNA binding domain
SMARTSM010194.5E-10491587IPR003340B3 DNA binding domain
PfamPF023627.4E-12500584IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MACRHFFKVV LEDTIRSGKL EIPRKFARDY GNHLSNPVFI KVPNGEIWEL EFTNSGGKMW  60
LQDGWQNFAE HYSVEPGHFL VFRYEGHCHF HAIIFDRTAT EIEYPDVNDN EGTQKQEVKI  120
KQESEDDEPV SIMNEISHGL REKPGLQCPR PHKTMKSEPM LSGFSAGTGR GEMESTTASK  180
VTSNEKFMVL QRVASAFQST NPFFLVLMQP TYVSHNPKHS CILGIPREFS RLFLKQNGNV  240
VLCDSNGKSW AAKYATSLGS NQRSYVRLCN GWGAFVRDKN LQVGDVCAFE LINCKQISFK  300
VSIFEGKKSG FHGSPPSTDG YFPAKRESGT SFTQPLKARE TALEKALAFT SENPFLVVVL  360
RPSYIRTDAL CISNHFARKH FESDLTSVDV NLCLSNGKSW PAKYLRRSIG NPNGKICHGW  420
KAFVNDNNLQ PGDVCVLEMT NHATKISFKV IIFKAIADAN SHPLEGVSQK PLGLTSQSLK  480
AATEMTSTLP FFRSVVLPLH LKEKRAGIPF GFVEQYLKPN METVILKVEN RSWPVKIASN  540
PQNRQARFTN GWIEFARENF LREGDICVYE LDAVKHGLLN VCISKSDD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453831.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like
TrEMBLA0A0D2T5X50.0A0A0D2T5X5_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1834349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.16e-35B3 family protein