PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_16857_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 378aa    MW: 42507.9 Da    PI: 8.197
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_16857_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.3e-344498155
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                kprl+Wtp+LHerF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Cotton_A_16857_BGI-A2_v1.0 44 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 98
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.01441101IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-314299IPR009057Homeodomain-like
SuperFamilySSF466897.53E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-234499IPR006447Myb domain, plants
PfamPF002494.3E-104697IPR001005SANT/Myb domain
PfamPF143796.3E-25144191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MYHHHQHQGK NINSSSRMAV HNERHLFLQG DHGDSGLMLS TDAKPRLKWT PDLHERFIEA  60
VNQLGGADKA TPKTVMKLMG IPGLTLYHLK SHLQKYRLSK NLHGQTNNGS TKIGAVAMAG  120
KRMSEANGSP INSLSIGPQA NKGIQIGEAL QMQIEVQRRL HEQLEVQRHL QLRIEAQGKY  180
LQSVLEKAQE TLHRQNLGTV GLEAAKLQLS ELVSKVSNQC LNSAFPDLKD LRGLCCQQTQ  240
PNPPNDCSMD SCLTSCEGSQ RDQEIHNNGM RLRTCNTHKD PLMHHQTETK TSENKTMGND  300
DDDDRRMFFA DRNCSDLSMS VGLRGSFSQA RNEEHSFLDV GNKRVDSVNR LPYFATKLDL  360
NVDEKHCKQF DLNGLSWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-2144100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-2144100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-2144100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-2144100157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017625173.10.0PREDICTED: myb-related protein 2-like
SwissprotQ9SQQ91e-146PHL9_ARATH; Myb-related protein 2
TrEMBLA0A1U8IHM00.0A0A1U8IHM0_GOSHI; uncharacterized protein LOC107894619 isoform X1
STRINGGorai.004G244800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-147G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]