PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_15600_BGI-A2_v1.0
Common NameF383_15530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 369aa    MW: 39858.3 Da    PI: 5.8861
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_15600_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.31.2e-11168226563
                                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                 kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +  v  l++e+
  Cotton_A_15600_BGI-A2_v1.0 168 KRAKRIMANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDVTGLTTEN 226
                                 9******************************************9999988888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-17164228IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783166229IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-10168223No hitNo description
SuperFamilySSF579591.05E-10168220No hitNo description
PfamPF001708.3E-10168226IPR004827Basic-leucine zipper domain
CDDcd147035.18E-25169220No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MQYPPLLNPN PLPPIPSKPN ASSTTQTALF FPNSTPFCGS HHRRAHSEVQ FRIPDELDLG  60
SDTFEGLGSE DDVFYNYVDI EKLGGSSKGP DEGGGSGSGI SGSSSGGSGQ NQKGEEINGG  120
SGKGEKNDGK GRHRYSNSVD GCSTMELIEA KKAMPPDKLA ELWNIDPKRA KRIMANRQSA  180
ARSKERKARY ITELERKVQT LQTEATTLSA QLTLFQRDVT GLTTENTELK LRLQAMDQQA  240
RLCDALNEAL KKEVEGLKIA TGEATTPTNT FNLGMHHIPY TQSSFLPPQP QHMQIDTLNV  300
QMPPFQPLQS NTLTTNPSMV GATNSYAFAD MMQQDPLGQL QGLDISSGGS HSVKSEGPSI  360
STSESSGTL
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017643965.10.0PREDICTED: transcription factor RF2b-like
SwissprotO228731e-104BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A0B0N5A80.0A0A0B0N5A8_GOSAR; Transcription factor RF2b
STRINGGorai.010G218700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.18e-96bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]