PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_15322_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 346aa    MW: 37494.1 Da    PI: 7.0238
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_15322_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.42.1e-3099152155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Cotton_A_15322_BGI-A2_v1.0  99 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 152
                                 59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.58E-2096156IPR009057Homeodomain-like
PROSITE profilePS5129411.05996155IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-3098157IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-24100152IPR006447Myb domain, plants
PfamPF002491.4E-7102151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MREEDSNWFS RWEEELPSPD ELMPLSQSLI TPDLAMAFDI RNPNHHHAQQ QQSSVQPAPP  60
PPSAAVQPSS QPTLAEFAAD SGDLGSGAAG DEPARTLKRP RLVWTPQLHK RFVDAVAHLG  120
IKNAVPKTIM QLMSVDGLTR ENVASHLQKY RLYLKRMQGL SGGSGGGANG GSGGAGLGAS  180
ADPATDHLFA SSPVPPHFLH PGRGNSEHFL PFVPVPALQH HHHHQQQQIV AAAVGHPHLQ  240
SQYHRPQMGH YGSSPNSQFE HPFLGRQTQQ PMHRIGGTPM HNQAPSSYVE DLESANGNGG  300
RKVLTFCADF TAAIKLPVAF CVLSQLLVMD INRDVSLSDN MFLGLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A6e-3299155157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431270.0AC243127.1 Gossypium raimondii clone GR__Ba0222F01-hob, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468058.10.0PREDICTED: transcription factor PCL1
RefseqXP_012468059.10.0PREDICTED: transcription factor PCL1
RefseqXP_012468060.10.0PREDICTED: transcription factor PCL1
RefseqXP_016707635.10.0PREDICTED: transcription factor PCL1
RefseqXP_016707636.10.0PREDICTED: transcription factor PCL1
RefseqXP_016707637.10.0PREDICTED: transcription factor PCL1
RefseqXP_017623383.10.0PREDICTED: transcription factor PCL1
RefseqXP_017623384.10.0PREDICTED: transcription factor PCL1
SwissprotO222104e-67MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A0B0NS740.0A0A0B0NS74_GOSAR; Two-component response regulator ARR1-like protein
TrEMBLA0A0D2QHN70.0A0A0D2QHN7_GOSRA; Uncharacterized protein
TrEMBLA0A1U8KZ050.0A0A1U8KZ05_GOSHI; transcription factor PCL1
STRINGGorai.002G230800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.13e-83G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]