PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_15103_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 472aa    MW: 51570.8 Da    PI: 6.1347
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_15103_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.75.3e-33240294155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 kpr+rWtpeLHe+Fveav++L G+ekAtPk +l+lm+v+gLt++hvkSHLQkYRl
  Cotton_A_15103_BGI-A2_v1.0 240 KPRMRWTPELHECFVEAVSKLDGPEKATPKGVLKLMNVEGLTIYHVKSHLQKYRL 294
                                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.456237297IPR017930Myb domain
SuperFamilySSF466898.78E-18238294IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-31239295IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-25240295IPR006447Myb domain, plants
PfamPF002493.9E-9242293IPR001005SANT/Myb domain
PfamPF143792.0E-20333379IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MKIGISSKTI NHPSFVSVTQ SGPSKGIGEP YPNAVSPIHN FPSRDLEGPS WLTGECSSLF  60
PLKKNELNSG PNSPSSPSSH AKGAFSHSSV FCTSLYLSSS STSETQRQLG NFPFLPHPPT  120
CHQFISAVDS SKSPVVFTED LCNPYDVDHS EVVMKDLLNF PGDACDDGCF HVELHFLSDE  180
LDIAINDHGE NPRVEEIYES PQPSSKPTVG LTCNQNSASA TPSMSAAVSP ALSGPAAVHK  240
PRMRWTPELH ECFVEAVSKL DGPEKATPKG VLKLMNVEGL TIYHVKSHLQ KYRLAKYMPE  300
KKEEKKTWSS GEKKAALSIG ESDGTKNGQL GTHITEALQM QIEVQKQLHE QLELQRMLQL  360
RIEEQARYLQ KILEEQQKAG SALIPTLSLS APTDPPNQNS ELQQPFSPSA VVSASQHSES  420
KTESSSSSLP SKHKGNGFSV NECKPESSLK RFRFEDKPES AIDEAVVENP VQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016749740.10.0PREDICTED: uncharacterized protein LOC107958474
SwissprotQ949U21e-117PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A1U8PF000.0A0A1U8PF00_GOSHI; uncharacterized protein LOC107958474
STRINGGorai.009G120900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-90G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]