PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_14818_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 163aa    MW: 18588.4 Da    PI: 10.3186
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_14818_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.12.2e-131151343
                                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                i n+s r++t+ kR +g+ KK  EL +LC++e+  +i s++
  Cotton_A_14818_BGI-A2_v1.0 11 ITNDSARKTTYKKRTKGLVKKVRELTTLCGIEAFAVINSPD 51
                                89*******************************99999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.138149IPR002100Transcription factor, MADS-box
SMARTSM004326.5E-17161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-19395IPR002100Transcription factor, MADS-box
CDDcd002661.61E-20386No hitNo description
PRINTSPR004043.4E-6323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-141151IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MSRKKTKLAY ITNDSARKTT YKKRTKGLVK KVRELTTLCG IEAFAVINSP DFGSQAEVWP  60
SLEDARRLLS EFKKLPLSKQ NNKMVNQESF LEQSLAKATQ QLRKLSEENR QKELEEVMFE  120
SLSGKGILQS LNAMDLDEVG RLVKQNLTDI DDRIRVLTKA SHS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431011e-84AC243101.1 Gossypium arboreum clone GM203N05-jhe, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017635023.11e-116PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK37e-44AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A2P5YTP11e-109A0A2P5YTP1_GOSBA; Uncharacterized protein
STRINGGorai.013G210300.11e-101(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-46AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]