PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_14429_BGI-A2_v1.0
Common NameF383_01633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 303aa    MW: 34657.3 Da    PI: 6.845
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_14429_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-072522852154
                                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  Cotton_A_14429_BGI-A2_v1.0 252 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 285
                                 469*****************************87 PP

2ELK27.38.4e-10206227122
                         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                 ELK +L+++Y++++ ++++E++
  Cotton_A_14429_BGI-A2_v1.0 206 ELKIELKQGYKSKIEDVREEIL 227
                                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.9E-163781IPR005540KNOX1
PfamPF037903.2E-153980IPR005540KNOX1
SMARTSM012563.6E-2395150IPR005541KNOX2
PfamPF037911.7E-1798149IPR005541KNOX2
PROSITE profilePS512139.568206226IPR005539ELK domain
PfamPF037891.7E-4206227IPR005539ELK domain
SMARTSM011880.0081206227IPR005539ELK domain
PROSITE profilePS5007111.645226289IPR001356Homeobox domain
SMARTSM003891.2E-10228293IPR001356Homeobox domain
SuperFamilySSF466896.42E-16228292IPR009057Homeodomain-like
CDDcd000861.18E-11229290No hitNo description
Gene3DG3DSA:1.10.10.604.3E-25233292IPR009057Homeodomain-like
PfamPF059201.0E-17246285IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MQEPELGMMA NFGGTTTAAI GGLSSRELSV PLDQNHRQLK AEIATHPLYD QLLTAHVSCL  60
RVATTIEQLP LIDAQLAQCH NVLRSYASQH PQHGHSLSPH HRQDLDNFLA QYLIMLCRFK  120
EELQQHVRVD AVEAVMACRE IENNLHALTG VTLGESTGAT MSDDEDELQM DFPLDNSGVE  180
ANDLMGFGPL LPTESERTLM ERVRKELKIE LKQGYKSKIE DVREEILRKR RAGKLPGDTT  240
SVLKNWWQQH SKWPYPTEDD KAKLVEETGL QLKQINNWFI NQRKRNWHTN YQSTTSLKSK  300
RKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1282302RKRNWHTNYQSTTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016724639.10.0PREDICTED: homeobox protein HD1-like
RefseqXP_017642739.10.0PREDICTED: homeobox protein HD1-like
SwissprotQ9FPQ81e-157KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A0B0PS880.0A0A0B0PS88_GOSAR; Homeobox protein knotted-1-like 7
TrEMBLA0A1U8MGE60.0A0A1U8MGE6_GOSHI; homeobox protein HD1-like
TrEMBLA0A2P5XKZ20.0A0A2P5XKZ2_GOSBA; Uncharacterized protein
STRINGGorai.008G242800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-160KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]