PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_14304_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 291aa    MW: 31655.6 Da    PI: 7.4374
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_14304_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.6e-3086139155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Cotton_A_14304_BGI-A2_v1.0  86 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 139
                                 59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05983142IPR017930Myb domain
SuperFamilySSF466892.69E-2083143IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-3085144IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-2487139IPR006447Myb domain, plants
PfamPF002491.1E-789138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MREIEDSSNL FGKWEEELPS PEELMPLSQT LITPHLALAF DIPNPNHRQR KHPPPPPPPP  60
PAEFAGDSGD LGSGAGGDEP ARTLKRPRLV WTPQLHKRFV DAVAHLGIKN AVPKTIMQLM  120
SVDGLTRENV ASHLQKYRLY LKRMQGLSGG GGANGGAASD PATDHLFASS PVPPHFLHPS  180
KGSSEPFSPF VSVPGLQHHH YQQQQHQLAA AAAVGHPHLL TQYHKQIGHF GSSPNGQFEH  240
PFLAKQPPPS IHRMGGTPSH NQVPNNYVED LESANGNGGM KVLTLFPPRD D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-3186142157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017628146.10.0PREDICTED: transcription factor PCL1 isoform X1
SwissprotO222102e-63MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A2P5Y4X51e-154A0A2P5Y4X5_GOSBA; Uncharacterized protein
STRINGGorai.007G351500.11e-152(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.11e-71G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]