PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_13400_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 324aa    MW: 36545.4 Da    PI: 7.0175
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_13400_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.96.2e-24953145
                                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                kr e++snrqvt+skRr+gilKKA+ELS+LCd+ + +++fs+tgk
  Cotton_A_13400_BGI-A2_v1.0  9 KRLESYSNRQVTYSKRRTGILKKAKELSILCDIHIILLMFSPTGK 53
                                689****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.077161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-25288IPR002100Transcription factor, MADS-box
CDDcd002663.74E-26281No hitNo description
PRINTSPR004041.1E-18323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-201156IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRVKLKIKR LESYSNRQVT YSKRRTGILK KAKELSILCD IHIILLMFSP TGKPTLFHGE  60
RSTIEEVIAK FAQLTPQERA KSYWNNPDKI DNIEHLRQME DSLRESIERI RIHKENYGKH  120
HLLPLESTSQ FQNAMPLPVM IGGVQEAQPV TWLPNNDNQQ MLLHNESNFL PNLDTECPTD  180
GSLAGYSGFF VPGNQTDIGN SVQVDNTIQE SNVLNELGNN AFLNSQLGKQ YLYPQFSASN  240
LQDDEKLKSE MVGNLQGGPG VYQVITDFEA PRTMSNGGHQ AWITSSGPCG IAMFDGNSYH  300
QELNLPAKSL IQIVVYRSKQ NRLL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5774415e-45JX577441.1 Gossypium hirsutum clone NBRI_GE9263 microsatellite sequence.
GenBankKU8964255e-45KU896425.1 Hibiscus cannabinus microsatellite HC_ES_49_GAG sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016722133.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_016722134.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_016722135.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
SwissprotQ7X9I03e-63AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A1U8M5U50.0A0A1U8M5U5_GOSHI; agamous-like MADS-box protein AGL65 isoform X1
STRINGGorai.008G194100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-65AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]