PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_13300_BGI-A2_v1.0
Common NameF383_23750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 218aa    MW: 24985.5 Da    PI: 10.3172
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_13300_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC40.75.1e-131122001199
                       NF-YC  11 ekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflv 93 
                                 e++++ k  ++P+ rik+i+k+++    +s ++  l+ ka elf+ ++    +  + + ++++l    ++++v + + +dfl 
  Cotton_A_13300_BGI-A2_v1.0 112 EEEEEAKVCRFPMNRIKRIIKTEDSHMAVSQDVVFLVNKAAELFLEKFCEDGYKCSIKDRKKSLSYKHLSTVVHEQKRYDFLS 194
                                 667788999****************9********************************************************* PP

                       NF-YC  94 divprd 99 
                                 d vp++
  Cotton_A_13300_BGI-A2_v1.0 195 DYVPQK 200
                                 ****86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471135.7E-17120201IPR009072Histone-fold
PfamPF008084.1E-14121184IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.6E-22122199IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MASSSKKPKE ENKNKKKHKE KSNRTADKDA KKSMKKPEKK GSASKIPTKS KPKPELKPDK  60
SKNKSSNGIP VKSQVITDPS SSSESEPQEN RNNYHKNVKL NSKRKRKEEV DEEEEEAKVC  120
RFPMNRIKRI IKTEDSHMAV SQDVVFLVNK AAELFLEKFC EDGYKCSIKD RKKSLSYKHL  180
STVVHEQKRY DFLSDYVPQK IKAEDALKVM NLAETGEG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477933.11e-107PREDICTED: DNA polymerase epsilon subunit C
TrEMBLA0A0B0NTK31e-156A0A0B0NTK3_G
STRINGPOPTR_0009s01750.11e-43(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-33nuclear factor Y, subunit C10