PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_13061_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 294aa    MW: 32472.4 Da    PI: 8.9262
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_13061_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.2e-32218271255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Cotton_A_13061_BGI-A2_v1.0 218 PRMRWTSSLHARFVRAVELLGGHERATPKSVLELMDVKDLTLSHVKSHLQMYRT 271
                                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-15215272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-29215272IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-24218271IPR006447Myb domain, plants
PfamPF002492.8E-7219270IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MFNKGDLCEQ YMNRVPDLTL QISPPNPAPS TACTGNSSFD IWRRNYALNS LTYGSQVDTQ  60
LSLANPASSA SQIDSPSPNY FPTTYDDQTR HRNLLKCGQN GGQLSNINHG ISLLDVPGPK  120
PTEGIPGYSN TMSLPFLSSD SFVDMDPDKL EFYSSSAASV LHSADACRRA SEAARFNGIS  180
LEKLRPQFHH HYAQHGPAMG SSRFIPKLQS SKRNTRTPRM RWTSSLHARF VRAVELLGGH  240
ERATPKSVLE LMDVKDLTLS HVKSHLQMYR TVKSSDKPAS SSGNSHCFDL VTLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-18219273458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-18219273458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-18219273357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-18219273357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-18219273357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-18219273357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-18219273458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-18219273458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-18219273458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-18219273458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-18219273458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-18219273458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017610436.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLA0A2P5XLX80.0A0A2P5XLX8_GOSBA; Uncharacterized protein
STRINGGorai.006G190900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17814510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.18e-42G2-like family protein