PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_11761_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 76aa    MW: 8772.34 Da    PI: 10.7373
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_11761_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.75.5e-281567153
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                                kprl+Wtp+LH+rFveav+q GG++kAt k+++++m++ gLtl+h+kSHLQ +
  Cotton_A_11761_BGI-A2_v1.0 15 KPRLKWTPQLHQRFVEAVNQVGGADKATLKSLMRIMGISGLTLYHLKSHLQAF 67
                                79*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-271367IPR009057Homeodomain-like
SuperFamilySSF466893.52E-151469IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-191568IPR006447Myb domain, plants
PfamPF002491.8E-61765IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MGHQNMNLVL STDTKPRLKW TPQLHQRFVE AVNQVGGADK ATLKSLMRIM GISGLTLYHL  60
KSHLQAFYHF FFCVIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-201567254Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-201567254Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-201567153Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-201567153Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-201567153Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-201567153Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-201567254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-201567254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-201567254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-201567254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-201567254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-201567254Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6142763e-52JX614276.1 Gossypium hirsutum clone NBRI_GE57551 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016679091.13e-42PREDICTED: uncharacterized protein LOC107898046
SwissprotQ9SQQ95e-28PHL9_ARATH; Myb-related protein 2
TrEMBLA0A2P5PZ984e-46A0A2P5PZ98_GOSBA; Uncharacterized protein
STRINGGorai.012G187000.12e-37(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.11e-30G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]