PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_11168_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 606aa    MW: 65374.8 Da    PI: 8.0401
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_11168_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR444.4e-14200236137
                         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCk 37 
                                 k++kgC+Ck+s Cl+kYCeCf+a+  Cse+CkC +Ck
  Cotton_A_11168_BGI-A2_v1.0 200 KHSKGCHCKRSGCLRKYCECFQANILCSESCKCMGCK 236
                                 589*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163426.942120240IPR005172CRC domain
SMARTSM011144.5E-14200239IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.1E-11203236IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MESDRLLEED EDWGNLDISR SLGTYWNLNG GRKRRPIPAK KNVQSDSADF PEKKLARQLH  60
FTAAFGGISA AAVVFPENPQ SKQGMDVASW SPAAASVNQR QQPQIKQQVA ATISVAAGQS  120
HPLTTASSSV VYCECFASGM YCDECNCVNC YKNVEYEAVR RDSVGATLKS NLNAFRPKIN  180
SSSHGAKDNK EAGEVLMLGK HSKGCHCKRS GCLRKYCECF QANILCSESC KCMGCKKFKG  240
SEERQALFHG DYANNMAYIQ QAANATTTGA IGSSGYASAP VSKKRKSQEL LLGSTAKDPS  300
VHSLGHLQQT NLIRASIPSS SLSSMSVSRA GTAVGPSKLS YRSLFADIIQ KQDLKELCSV  360
LVVLSREAAK ILADQRSLIE GAEDHSEISL ASSTQDKLES QKDFVAEKTR ADNCSSANQA  420
VKSGPENSCT DVADMPEGRP MSPATLALMC DEQDTTFTAA ASLNGIMDDG YSTSSQLPCG  480
KGMIQIDAEH ERVVLTKFRD CLNRLITFGE IKGNGNLTML LLPITRMQCS TLARIEIGSQ  540
RCPLSHRAET GNQQGFVNYG VPKTFFSPTV RTSKTDAVVT TADNDLPTVP PFPGNGDAKS  600
KPAKQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-2313124924132Protein lin-54 homolog
5fd3_B2e-2313124924132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016689961.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X2
SwissprotQ9SZD11e-142TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A1U8JI610.0A0A1U8JI61_GOSHI; protein tesmin/TSO1-like CXC 5 isoform X2
STRINGGorai.009G025900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-141Tesmin/TSO1-like CXC domain-containing protein