PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_11128_BGI-A2_v1.0
Common NameF383_29826
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 471aa    MW: 50893.5 Da    PI: 7.0814
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_11128_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.2e-32250305156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Cotton_A_11128_BGI-A2_v1.0 250 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVEGLTNDEVKSHLQKYRLH 305
                                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.407247307IPR017930Myb domain
SuperFamilySSF466891.15E-16248308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28248308IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26250305IPR006447Myb domain, plants
PfamPF002498.4E-7252303IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MASPTGLTLD CKPHSYSMLL KSFGDQQIDQ TQKLEDFLGR LEEERLKIDA FKRELPLCMQ  60
LLTNAVEASR QQLHACRANQ GSRPVLEEFI PLKNSSSENS DKSQNISDKA NWMTSAQLWS  120
QAGNETKPPQ SSVASPKEAD IGFNVSPKLG LDTKQRNGGA FLPFSKDRNN PCPGSTLQPL  180
PDLALASMNE DMDDKKCSEA ENGCQRRENS GKTGNGGALV EQGKGTSCNA AEGQTTNGNT  240
NTNTGQPHRK ARRCWSPDLH RRFVNALQML GGSQVATPKQ IRELMKVEGL TNDEVKSHLQ  300
KYRLHTRRPS PSPQAPGAPA PQLVVLGGIW VSPEYATAAA AAHGGAPTLY GAHHPVASHA  360
PPPHFCASPV PQEFYSTTAT PASTPPPQLH HHTLQQQLHM YKSTSQAHSL PESDVRGAGD  420
RSESIEDGKS ESSSWKGESG ENGGGADQRK GLAALREDGE ESNGSEITLK F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-14250303154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-14250303154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-14250303154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-14250303154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6150642e-32JX615064.1 Gossypium hirsutum clone NBRI_GE58863 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017610040.10.0PREDICTED: myb family transcription factor EFM
SwissprotQ9ZQ851e-137EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A0B0MUB90.0A0A0B0MUB9_GOSAR; Two-component response regulator ARR18-like protein
STRINGGorai.009G022100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-110G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]