PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_11086_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 723aa    MW: 79097.5 Da    PI: 7.2022
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_11086_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.94.1e-094274641954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +++  L+k++gLt +qV++WF N R +
  Cotton_A_11086_BGI-A2_v1.0 427 FEHflHPYPKDSDKHMLSKQTGLTRSQVSNWFINARVR 464
                                 554458******************************88 PP

2BELL121.14.8e-39290361172
                        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 +rqelq+kkakL+++l+eV++rY+qy++q+q+v++sFe++aglg+ak+Yt+lAl++iS++FrcLkdai+ qi
  Cotton_A_11086_BGI-A2_v1.0 290 QRQELQMKKAKLVNMLDEVEQRYRQYHHQMQMVVASFEQAAGLGAAKSYTALALQTISKQFRCLKDAISCQI 361
                                 69*******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.9E-65216359IPR006563POX domain
PfamPF075262.8E-50221358IPR006563POX domain
PROSITE profilePS5007111.418405468IPR001356Homeobox domain
SMARTSM003891.8E-8408472IPR001356Homeobox domain
CDDcd000866.07E-12408469No hitNo description
SuperFamilySSF466892.01E-16409475IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-28411475IPR009057Homeodomain-like
PfamPF059208.3E-18425464IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MATYIHGSSE FQAAPAASDG MQTLYLMNPN YVPYSDTHQP ATATNMFFLN PAGNSLNPIS  60
LPHAPPSNYN HFLGLPLPSP TPSIGPSDSD EPNRPPPLVS GVHHNLWGSS IDQQNSSPGS  120
SSHPQLVSAV ARAGNSGGPL DVISQLGLRR SGVSPRQGLS LSLSSQQVPY RSSNVETVIQ  180
GRPEVAVPPT TSLAADDMRI SGSSPSTVSV VSNGISGVQS VVLGSKYLRA VQELLDEVVN  240
VGKGIKTHPS GGTKEKTKAA KTEPVAAVNG DGSSAGENGV EPGPELTTAQ RQELQMKKAK  300
LVNMLDEVEQ RYRQYHHQMQ MVVASFEQAA GLGAAKSYTA LALQTISKQF RCLKDAISCQ  360
IKATNKSLGE EDCLGVKMEG SRLRYVDNQI RQQRALQQLG MIQHHNAWRP QRGLPERAVC  420
VLRAWLFEHF LHPYPKDSDK HMLSKQTGLT RSQVSNWFIN ARVRLWKPMV EEMYMEEIKE  480
QERNTNGSEE INADKNEQQM EPGSYSGGQT MDQVKAQSKP SSISQNNNNN ITSHADQFSN  540
STISTSPMGG SLVQQTSFNL IGSSDLDRSP KKPRNKLQNP AFGILPMEME MEMKQGETRE  600
INMRFGDERL FKDYSYSYLS GTVYSSMREV GRFNHGQQLP PGFPGNSGVS LTLGLPHCEN  660
LSLSGNHQNF VPNQNINDVE GATQSDFCAI NTQPQPSHST TYDTMEMQSR KRFAAPLLPD  720
FVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15414472563Homeobox protein Meis2
3k2a_B1e-15414472563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5266895e-65HQ526689.1 Gossypium herbaceum clone NBRI_B_1357 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017605276.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_017605277.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_017605278.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A2P5X7A20.0A0A2P5X7A2_GOSBA; Uncharacterized protein
STRINGGorai.009G082700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16274513
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-118BEL1-like homeodomain 1