PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_10788_BGI-A2_v1.0
Common NameF383_23897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 409aa    MW: 45590.1 Da    PI: 8.4766
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_10788_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.2e-33264319156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Cotton_A_10788_BGI-A2_v1.0 264 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 319
                                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.35E-18261322IPR009057Homeodomain-like
PROSITE profilePS5129414.115261321IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-29262322IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-27264319IPR006447Myb domain, plants
PfamPF002496.4E-8266317IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MGSVPPELSL DFRPTFVPKT ISTFLKEVSL IGNVPDKVSK LDAFVKRLEE EMRKIDAFKR  60
ELPLCMLLLN DAIVALKEES VQCMSRNVEP VLEEFIPLKN KKENNQSEED GALITNKKEK  120
DSNNNNCNNN KDKKNWMSSV QLWNTDDDYS SISHKLDSKR KDGDSSQGCK NRGTATAFMP  180
FKMNLGFAVR KEEKEEIPVH GLTLLTPGIK NLKEESCSTG SRTSCSRAVS SSAPNAQSTF  240
RSVPQPLSHH QQQQQQQQQQ TARKQRRCWS PELHRRFVNA LQQLGGSQVA TPKQIRELMQ  300
VDGLTNDEVK SHLQKYRLHT RRLPASTTSP ANQSVVVLGS GLWMSQDQYG ESSKGSSSQS  360
GSPQGPLQLA TNTGGTSNPG GDSMEDDEDA KSESYSWKSH IHKPGKDDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-14264317255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-14264317255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-14264317154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-14264317154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-14264317154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-14264317154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-14264317255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-14264317255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-14264317255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-14264317255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-14264317255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-14264317255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017634829.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A1U8M1500.0A0A1U8M150_GOSHI; Uncharacterized protein
STRINGGorai.008G026300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145351021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-49G2-like family protein