PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_10669_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 320aa    MW: 36168.3 Da    PI: 4.4678
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_10669_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-092502822355
                                 SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                    Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                 +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  Cotton_A_10669_BGI-A2_v1.0 250 PYPTEEEKLKLSEMTGLDQKQINNWFINQRKRH 282
                                 8*****************************885 PP

2ELK377e-13202223122
                         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                 ++K +L+rKYsgyL+sL++EF+
  Cotton_A_10669_BGI-A2_v1.0 202 DIKGMLMRKYSGYLSSLRKEFL 223
                                 58*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.2E-2162106IPR005540KNOX1
PfamPF037902.7E-2064105IPR005540KNOX1
SMARTSM012562.9E-26109160IPR005541KNOX2
PfamPF037915.8E-25112159IPR005541KNOX2
SMARTSM011882.4E-6202223IPR005539ELK domain
PROSITE profilePS5121310.58202222IPR005539ELK domain
PfamPF037891.1E-9202223IPR005539ELK domain
PROSITE profilePS5007112.066222285IPR001356Homeobox domain
SuperFamilySSF466892.82E-19224292IPR009057Homeodomain-like
SMARTSM003897.8E-12224289IPR001356Homeobox domain
CDDcd000868.07E-15225286No hitNo description
Gene3DG3DSA:1.10.10.605.0E-26227287IPR009057Homeodomain-like
PfamPF059205.9E-17242281IPR008422Homeobox KN domain
PROSITE patternPS000270260283IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEDIYRLDDT VIACSNDVVR VNDFAAAVTT DFLSTPVDDH HLLQFDHQET DTGVTGSSAM  60
SDLIKTQIAT HPLYPNLVSA YIECQKVGAP PELASLLEEI DRESHTISGC GEIGADPELD  120
EFMESYCEVL HRYKEELSKP FDEATTFLTN IESQLSDLCK GALTMDYRTD EGAESSDGEL  180
SGGELVEACE SQEWHGGRRS QDIKGMLMRK YSGYLSSLRK EFLKKRKNGK LPKDARLTLL  240
DWWNNHYRWP YPTEEEKLKL SEMTGLDQKQ INNWFINQRK RHWKPSEDMK FALMEDVAGS  300
IRGGPTYFDT GAGIGTADDI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217226LRKEFLKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2817732e-32GQ281773.1 Prunus persica class I KNOX homeobox transcription factor KNOPE6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017628863.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP292e-96KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A2P5VVM50.0A0A2P5VVM5_GOSBA; Uncharacterized protein
STRINGGorai.007G306500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.12e-92KNOTTED-like from Arabidopsis thaliana 2
Publications ? help Back to Top
  1. Park SH, et al.
    A Ds-insertion mutant of OSH6 (Oryza sativa Homeobox 6) exhibits outgrowth of vestigial leaf-like structures, bracts, in rice.
    Planta, 2007. 227(1): p. 1-12
    [PMID:17624547]