PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_10427_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 367aa    MW: 39972.8 Da    PI: 5.6662
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_10427_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573134.73.3e-42147242297
                      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskeh 84 
                                 lfqrl+se+Dei+lL+G++d+ aktg++p+ d+++fy+fvkksi+ +vsk ql++K+rrLKkKfk++v k k+g++p+fsk+h
  Cotton_A_10427_BGI-A2_v1.0 147 LFQRLFSEDDEIALLKGMLDYSAKTGADPHTDMNGFYDFVKKSIHTNVSKVQLMDKVRRLKKKFKNNVGKNKKGEDPTFSKAH 229
                                 69********************************************************************************* PP

                      DUF573  85 dqkifelskkiWg 97 
                                 +qk+felskkiWg
  Cotton_A_10427_BGI-A2_v1.0 230 EQKAFELSKKIWG 242
                                 ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-36148242IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MAPKRSNPVE VPAPAFSSEE DEKVTSSEEV EEEGSSTEEE GEEDSKTKPT PLIHNTPPPR  60
KLETANDESD ESGSDSESES DTALPVAIAT KPGSNKPLAS SSKRPGESGL DAKEGKRPKK  120
KVGGEGMATA PVVEEVKRTG EDAKKLLFQR LFSEDDEIAL LKGMLDYSAK TGADPHTDMN  180
GFYDFVKKSI HTNVSKVQLM DKVRRLKKKF KNNVGKNKKG EDPTFSKAHE QKAFELSKKI  240
WGVSGKVESS TAKSNGKAKG NNKAVAALKA ELPSSSDKKT DNAVPIEVDN VVSKSSSSLL  300
DMKFSVSDTE VGVVKVGLDM VDGEKKAALE AKWRKLQMAQ LDLFVERTEF VTEQAKLALK  360
YYKSEDE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454073.10.0PREDICTED: mediator-associated protein 1-like
RefseqXP_012454074.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D2TC680.0A0A0D2TC68_G
STRINGPOPTR_0001s30110.19e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.18e-30DNA-binding storekeeper protein-related transcriptional regulator