PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_10349_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 620aa    MW: 66419.3 Da    PI: 7.5111
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_10349_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.14.2e-14121160242
                         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                                 ++k+CnCk+s+Clk+YCeCfa+g++C+  C+C +C N+ e+
  Cotton_A_10349_BGI-A2_v1.0 121 KQKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCYNNVEN 160
                                 89**************************.********9875 PP

2TCR50.83.3e-16205244140
                         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                 k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Cotton_A_10349_BGI-A2_v1.0 205 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 244
                                 589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.8E-15120160IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.932121245IPR005172CRC domain
PfamPF036388.9E-11122157IPR005172CRC domain
SMARTSM011148.4E-20205246IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12208243IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MGKEEGGEIP PKMVQSDTAD FPSKKLARQL DFTVGFGGVS SGSVNLPEHP QSTQRIGVAS  60
PSASVTVQQQ QIKPPTEVAA AVPVVAAQHP PLTTASTRVV KPESPKAKPR PNELKDGTPK  120
KQKQCNCKHS RCLKLYCECF ASGTYCDGCN CVNCYNNVEN EAARRDAIEA TLERNPNAFR  180
PKIASSPHGA GDSREEAGEV LMLAKHNKGC HCKKSGCLKK YCECFQANIL CSENCKCMDC  240
KNFEGSEERQ ALFHGDHANN MAYIQQAANA AITGAIGSSG YASTPVSKKR KGQELFFGST  300
AKDPSVHRLG NFPQPHHIRA SAPASSLSSV PASRAGTTAA VGPSKFTYRS LLADIIQKQD  360
LKELCSVLVV LSGEVDKTLS DQIILTDKRA EDHAETSIAS STQDRLQNQK DSDAEKTTAD  420
DCSSANQADK AGPEESSSDG ADMPKGRPMS PGTLALMCDE QDTMFMASAS PNRIMGHGCS  480
TSSQLPYEQG MTEIYAEQER IVLTKFRDCL NRLITFGEIK ETQCSSLART EIGSQRGHPS  540
NGTETVRNET GNQQGSITNG VAKNASPPTV KTSPMTASVI TASNNDLSRG PSHPENGDAK  600
SKSEKTDVKT INDADNRPKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-331132542132Protein lin-54 homolog
5fd3_B8e-331132542132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017627672.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A2P5WX780.0A0A2P5WX78_GOSBA; Uncharacterized protein
STRINGGorai.001G006500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein