PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_10271_BGI-A2_v1.0
Common NameF383_23578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 433aa    MW: 48032.9 Da    PI: 5.6364
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_10271_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-33227281155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 kpr+rWtpeLHerFveav++L G+ekAtPk +l+lm+v+gLt++hvkSHLQkYRl
  Cotton_A_10271_BGI-A2_v1.0 227 KPRMRWTPELHERFVEAVNKLHGPEKATPKGVLKLMNVEGLTIYHVKSHLQKYRL 281
                                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.732224284IPR017930Myb domain
SuperFamilySSF466893.23E-18225281IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-25227282IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.2E-31227282IPR009057Homeodomain-like
PfamPF002498.5E-10229280IPR001005SANT/Myb domain
PfamPF143791.6E-22318365IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MTQSEPSKGI GEPYPIAAFP AHKILSIQSE GQSPMAGECS SRLSFPFNSP RSDAKNASSS  60
SSVFCTSLYL SSSSTSETQR QLGNLPFLPH PPTCHQFISS VDSSKSPAVF SEDLNNPYNE  120
GHSEIIMKDF LNLPADASSD GCFYGMHCES DDFGITTEQL ELQFLSDELD IAITDHGENP  180
RLDEIYGTCP PSSAKPTVEL KCNQNTNSVS PTIDGPAMYG AAAAVLKPRM RWTPELHERF  240
VEAVNKLHGP EKATPKGVLK LMNVEGLTIY HVKSHLQKYR LAKYMPEKKE ERKTSSSSEE  300
KKPASSSNES DGKKRGGMHI TEALRMQMEV QKQLHEQLEL QRSLQLRIEE HARYLQKMLE  360
EQQKAGNALV PNPNSELPSR IASETEPCES KTESPTSLPS KYKAPNVEEC KLKSSPKRLR  420
MDEAEAEVEN PEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-26227284259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-26227284259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-26227284259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-26227284259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-26227284259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-26227284259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-26227284259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-26227284259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017648855.10.0PREDICTED: myb family transcription factor PHL6-like
SwissprotQ949U21e-127PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A0B0MQE70.0A0A0B0MQE7_GOSAR; Myb family transcription factor APL
STRINGGorai.011G001500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-92G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]